Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACN08A_RS11680 Genome accession   NZ_CP184653
Coordinates   2308333..2308851 (+) Length   172 a.a.
NCBI ID   WP_016250467.1    Uniprot ID   A0A0H2QMK6
Organism   Enterococcus cecorum strain 2023EC-GS-SDAU-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2284525..2339044 2308333..2308851 within 0
IScluster/Tn 2306033..2307596 2308333..2308851 flank 737


Gene organization within MGE regions


Location: 2284525..2339044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN08A_RS11570 (ACN08A_11610) - 2285287..2285652 (+) 366 WP_016250489.1 transposase -
  ACN08A_RS11575 (ACN08A_11615) - 2285905..2286207 (+) 303 WP_016250488.1 heavy metal-binding domain-containing protein -
  ACN08A_RS11580 (ACN08A_11620) tnpA 2286335..2286739 (-) 405 WP_016250487.1 IS200/IS605 family transposase -
  ACN08A_RS11585 (ACN08A_11625) iscB 2286697..2287983 (-) 1287 WP_016250486.1 RNA-guided endonuclease IscB -
  ACN08A_RS11590 (ACN08A_11630) - 2288711..2289799 (-) 1089 WP_311897559.1 glycerate kinase -
  ACN08A_RS11595 (ACN08A_11635) jag 2290051..2290848 (-) 798 WP_243170170.1 RNA-binding cell elongation regulator Jag/EloR -
  ACN08A_RS11600 (ACN08A_11640) - 2290861..2291676 (-) 816 WP_087402502.1 YidC/Oxa1 family membrane protein insertase -
  ACN08A_RS11605 (ACN08A_11645) rnpA 2291716..2292069 (-) 354 WP_016250482.1 ribonuclease P protein component -
  ACN08A_RS11610 (ACN08A_11650) rpmH 2292579..2292713 (-) 135 WP_006703104.1 50S ribosomal protein L34 -
  ACN08A_RS11615 (ACN08A_11655) dnaA 2293320..2294654 (+) 1335 WP_087402500.1 chromosomal replication initiator protein DnaA -
  ACN08A_RS11620 (ACN08A_11660) dnaN 2294843..2295973 (+) 1131 WP_171310443.1 DNA polymerase III subunit beta -
  ACN08A_RS11625 (ACN08A_11665) - 2296380..2297591 (+) 1212 WP_311897557.1 MFS transporter -
  ACN08A_RS11630 (ACN08A_11670) - 2297729..2298064 (+) 336 WP_171313919.1 AbrB family transcriptional regulator -
  ACN08A_RS11635 (ACN08A_11675) yaaA 2298318..2298566 (+) 249 WP_113784815.1 S4 domain-containing protein YaaA -
  ACN08A_RS11640 (ACN08A_11680) recF 2298553..2299692 (+) 1140 WP_047334536.1 DNA replication/repair protein RecF -
  ACN08A_RS11645 (ACN08A_11685) gyrB 2299719..2301668 (+) 1950 WP_311897556.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  ACN08A_RS11650 (ACN08A_11690) gyrA 2301689..2304193 (+) 2505 WP_311897554.1 DNA gyrase subunit A -
  ACN08A_RS11655 (ACN08A_11695) - 2304409..2304780 (+) 372 WP_311897553.1 MmcQ/YjbR family DNA-binding protein -
  ACN08A_RS11660 (ACN08A_11700) - 2304777..2305850 (+) 1074 WP_311897552.1 endonuclease/exonuclease/phosphatase family protein -
  ACN08A_RS11665 (ACN08A_11705) tnpA 2306033..2306437 (+) 405 WP_113842998.1 IS200/IS605 family transposase -
  ACN08A_RS11670 (ACN08A_11710) tnpB 2306454..2307596 (+) 1143 WP_311897550.1 IS200/IS605 family element RNA-guided endonuclease TnpB -
  ACN08A_RS11675 (ACN08A_11715) rpsF 2307991..2308290 (+) 300 WP_016250468.1 30S ribosomal protein S6 -
  ACN08A_RS11680 (ACN08A_11720) ssb 2308333..2308851 (+) 519 WP_016250467.1 single-stranded DNA-binding protein Machinery gene
  ACN08A_RS11685 (ACN08A_11725) rpsR 2308881..2309117 (+) 237 WP_016250466.1 30S ribosomal protein S18 -
  ACN08A_RS11690 (ACN08A_11730) - 2309297..2309725 (+) 429 WP_311897549.1 NUDIX hydrolase -
  ACN08A_RS11695 (ACN08A_11735) - 2310121..2314329 (+) 4209 WP_420285339.1 polysaccharide lyase family 8 super-sandwich domain-containing protein -
  ACN08A_RS11700 (ACN08A_11740) - 2314538..2315989 (+) 1452 WP_171379165.1 DHH family phosphoesterase -
  ACN08A_RS11705 (ACN08A_11745) rplI 2316002..2316454 (+) 453 WP_016250461.1 50S ribosomal protein L9 -
  ACN08A_RS11710 (ACN08A_11750) - 2316526..2316993 (+) 468 WP_311897547.1 NUDIX hydrolase -
  ACN08A_RS11715 (ACN08A_11755) dnaB 2317149..2318519 (+) 1371 WP_311897546.1 replicative DNA helicase -
  ACN08A_RS11720 (ACN08A_11760) - 2318569..2318889 (-) 321 WP_168931907.1 hypothetical protein -
  ACN08A_RS11725 (ACN08A_11765) - 2319309..2321471 (+) 2163 WP_311897545.1 PTS transporter subunit IIBC -
  ACN08A_RS11730 (ACN08A_11770) - 2321572..2322369 (+) 798 WP_311897544.1 endonuclease/exonuclease/phosphatase family protein -
  ACN08A_RS11735 (ACN08A_11775) - 2322631..2323923 (+) 1293 WP_168931902.1 adenylosuccinate synthase -
  ACN08A_RS11740 (ACN08A_11780) - 2324347..2325192 (+) 846 WP_311897543.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACN08A_RS11745 (ACN08A_11785) - 2325464..2326666 (-) 1203 WP_087216125.1 MFS transporter -
  ACN08A_RS11750 (ACN08A_11790) - 2326977..2328608 (-) 1632 WP_016250453.1 ABC-F family ATP-binding cassette domain-containing protein -
  ACN08A_RS11755 (ACN08A_11795) - 2328955..2329905 (+) 951 WP_311897562.1 ABC transporter ATP-binding protein -
  ACN08A_RS11760 (ACN08A_11800) - 2329915..2330508 (+) 594 WP_311897542.1 ABC transporter ATP-binding protein -
  ACN08A_RS11765 (ACN08A_11805) - 2330674..2331660 (-) 987 WP_168931973.1 LacI family DNA-binding transcriptional regulator -
  ACN08A_RS11770 (ACN08A_11810) - 2331960..2332769 (+) 810 WP_376716576.1 PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC -
  ACN08A_RS11775 (ACN08A_11815) - 2332756..2333568 (+) 813 WP_016250446.1 PTS system mannose/fructose/sorbose family transporter subunit IID -
  ACN08A_RS11780 (ACN08A_11820) - 2333593..2335062 (+) 1470 WP_168931972.1 arylsulfatase -
  ACN08A_RS11785 (ACN08A_11825) - 2335092..2336213 (+) 1122 WP_016250444.1 radical SAM/SPASM domain-containing protein -
  ACN08A_RS11790 (ACN08A_11830) - 2336210..2336983 (+) 774 WP_311897540.1 sulfite exporter TauE/SafE family protein -
  ACN08A_RS11795 (ACN08A_11835) - 2337061..2337416 (+) 356 Protein_2266 PTS lactose/cellobiose transporter subunit IIA -
  ACN08A_RS11800 (ACN08A_11840) - 2337689..2339044 (-) 1356 Protein_2267 ISL3 family transposase -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 19042.89 Da        Isoelectric Point: 4.7093

>NTDB_id=1110615 ACN08A_RS11680 WP_016250467.1 2308333..2308851(+) (ssb) [Enterococcus cecorum strain 2023EC-GS-SDAU-1]
MINNVVLVGRLTRDPDLRYTSSGVAVATFSLAVNRNFTSQNGERETDFINCVIWRKPAETLANYARKGTLIGLTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESKAVNDQRRQAAGNFDNNVSQPFNNNNNSFDQPASSQPFSGMPGFDRDASNTPLGG
SSIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=1110615 ACN08A_RS11680 WP_016250467.1 2308333..2308851(+) (ssb) [Enterococcus cecorum strain 2023EC-GS-SDAU-1]
TTGATTAATAATGTTGTATTAGTAGGTAGATTAACAAGAGACCCTGATTTACGTTACACTTCTTCTGGTGTTGCGGTGGC
TACTTTTAGTTTAGCTGTGAACCGTAATTTTACCAGCCAAAACGGAGAAAGAGAAACGGACTTTATCAATTGTGTCATTT
GGCGTAAACCAGCTGAAACTTTAGCAAATTACGCTAGAAAAGGGACATTAATTGGTTTGACCGGACGTATTCAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTGTACGTAACTGAAGTGGTTGCCGATAATTTTCAATTATTAGAGTCTAAAGC
AGTCAATGATCAACGTCGTCAAGCTGCCGGAAACTTTGATAATAATGTCTCACAACCATTTAACAATAATAACAATAGCT
TTGATCAGCCAGCTTCATCTCAACCATTTAGTGGAATGCCTGGCTTTGACCGTGATGCAAGTAACACACCACTTGGCGGA
TCAAGCATTGACATTTCAGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2QMK6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.345

100

0.61

  ssbA Bacillus subtilis subsp. subtilis str. 168

53.409

100

0.547

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

61.628

0.366


Multiple sequence alignment