Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACOBR6_RS01025 | Genome accession | NZ_CP184530 |
| Coordinates | 217106..217564 (-) | Length | 152 a.a. |
| NCBI ID | WP_420222888.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain HI5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 187750..228253 | 217106..217564 | within | 0 |
Gene organization within MGE regions
Location: 187750..228253
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACOBR6_RS00815 (ACOBR6_00815) | - | 187750..188874 (-) | 1125 | WP_420222850.1 | peptidoglycan recognition family protein | - |
| ACOBR6_RS00820 (ACOBR6_00820) | - | 188871..189392 (-) | 522 | WP_420222851.1 | phage holin family protein | - |
| ACOBR6_RS00825 (ACOBR6_00825) | - | 189431..189607 (-) | 177 | WP_420222852.1 | hypothetical protein | - |
| ACOBR6_RS00830 (ACOBR6_00830) | - | 189712..189840 (-) | 129 | WP_420222853.1 | XkdX family protein | - |
| ACOBR6_RS00835 (ACOBR6_00835) | - | 189840..190178 (-) | 339 | WP_420222854.1 | DUF2977 domain-containing protein | - |
| ACOBR6_RS00840 (ACOBR6_00840) | - | 190179..190991 (-) | 813 | WP_420222855.1 | hypothetical protein | - |
| ACOBR6_RS00845 (ACOBR6_00845) | - | 190991..192862 (-) | 1872 | WP_420222856.1 | metallophosphoesterase family protein | - |
| ACOBR6_RS00850 (ACOBR6_00850) | - | 192864..193172 (-) | 309 | WP_420222857.1 | hypothetical protein | - |
| ACOBR6_RS00855 (ACOBR6_00855) | - | 193172..193960 (-) | 789 | WP_420222858.1 | GH25 family lysozyme | - |
| ACOBR6_RS00860 (ACOBR6_00860) | - | 193926..195875 (-) | 1950 | WP_420222859.1 | phage tail protein | - |
| ACOBR6_RS00865 (ACOBR6_00865) | - | 195872..196708 (-) | 837 | WP_420222860.1 | phage tail domain-containing protein | - |
| ACOBR6_RS00870 (ACOBR6_00870) | - | 196721..201208 (-) | 4488 | WP_420222861.1 | phage tail tape measure protein | - |
| ACOBR6_RS00875 (ACOBR6_00875) | - | 201227..201445 (-) | 219 | WP_420222862.1 | phage tail tape measure protein | - |
| ACOBR6_RS00880 (ACOBR6_00880) | gpG | 201493..201804 (-) | 312 | WP_420222863.1 | phage tail assembly chaperone G | - |
| ACOBR6_RS00885 (ACOBR6_00885) | - | 201860..202117 (-) | 258 | WP_420222864.1 | phosphoenolpyruvate synthase | - |
| ACOBR6_RS00890 (ACOBR6_00890) | - | 202183..202797 (-) | 615 | WP_420222865.1 | major tail protein | - |
| ACOBR6_RS00895 (ACOBR6_00895) | - | 202815..203231 (-) | 417 | WP_420222866.1 | hypothetical protein | - |
| ACOBR6_RS00900 (ACOBR6_00900) | - | 203228..203635 (-) | 408 | WP_420222867.1 | hypothetical protein | - |
| ACOBR6_RS00905 (ACOBR6_00905) | - | 203632..204012 (-) | 381 | WP_420222868.1 | hypothetical protein | - |
| ACOBR6_RS00910 (ACOBR6_00910) | - | 203972..204301 (-) | 330 | WP_420222869.1 | phage gp6-like head-tail connector protein | - |
| ACOBR6_RS00915 (ACOBR6_00915) | - | 204301..204450 (-) | 150 | WP_420223130.1 | HeH/LEM domain-containing protein | - |
| ACOBR6_RS00920 (ACOBR6_00920) | - | 204444..205619 (-) | 1176 | WP_420222870.1 | phage major capsid protein | - |
| ACOBR6_RS00925 (ACOBR6_00925) | - | 205644..206402 (-) | 759 | WP_420222871.1 | head maturation protease, ClpP-related | - |
| ACOBR6_RS00930 (ACOBR6_00930) | - | 206386..207531 (-) | 1146 | WP_420222872.1 | phage portal protein | - |
| ACOBR6_RS00935 (ACOBR6_00935) | - | 207553..209235 (-) | 1683 | WP_420222873.1 | terminase TerL endonuclease subunit | - |
| ACOBR6_RS00940 (ACOBR6_00940) | - | 209232..209564 (-) | 333 | WP_420222874.1 | P27 family phage terminase small subunit | - |
| ACOBR6_RS00945 (ACOBR6_00945) | - | 210133..210459 (-) | 327 | WP_420222875.1 | HNH endonuclease | - |
| ACOBR6_RS00950 (ACOBR6_00950) | - | 210461..210754 (-) | 294 | WP_420222876.1 | hypothetical protein | - |
| ACOBR6_RS00955 (ACOBR6_00955) | - | 210968..211804 (-) | 837 | WP_420222877.1 | hypothetical protein | - |
| ACOBR6_RS00960 (ACOBR6_00960) | - | 212177..212635 (-) | 459 | WP_420222878.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| ACOBR6_RS00965 (ACOBR6_00965) | - | 212710..212994 (-) | 285 | WP_420222879.1 | hypothetical protein | - |
| ACOBR6_RS00970 (ACOBR6_00970) | - | 213136..213423 (-) | 288 | WP_420222880.1 | hypothetical protein | - |
| ACOBR6_RS00975 (ACOBR6_00975) | - | 213434..213598 (-) | 165 | WP_347921115.1 | DUF7336 domain-containing protein | - |
| ACOBR6_RS00980 (ACOBR6_00980) | - | 213616..213798 (-) | 183 | WP_176582131.1 | hypothetical protein | - |
| ACOBR6_RS00985 (ACOBR6_00985) | - | 213798..214031 (-) | 234 | WP_176582132.1 | hypothetical protein | - |
| ACOBR6_RS00990 (ACOBR6_00990) | - | 214031..214621 (-) | 591 | WP_420222881.1 | DUF1642 domain-containing protein | - |
| ACOBR6_RS00995 (ACOBR6_00995) | - | 214791..215162 (-) | 372 | WP_420222882.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACOBR6_RS01000 (ACOBR6_01000) | - | 215149..215298 (-) | 150 | WP_420222883.1 | hypothetical protein | - |
| ACOBR6_RS01005 (ACOBR6_01005) | - | 215295..215696 (-) | 402 | WP_420222884.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACOBR6_RS01010 (ACOBR6_01010) | - | 215689..215901 (-) | 213 | WP_420222885.1 | hypothetical protein | - |
| ACOBR6_RS01015 (ACOBR6_01015) | - | 215911..216141 (-) | 231 | WP_420222886.1 | hypothetical protein | - |
| ACOBR6_RS01020 (ACOBR6_01020) | - | 216145..217092 (-) | 948 | WP_420222887.1 | DnaD domain-containing protein | - |
| ACOBR6_RS01025 (ACOBR6_01025) | ssb | 217106..217564 (-) | 459 | WP_420222888.1 | single-stranded DNA-binding protein | Machinery gene |
| ACOBR6_RS01030 (ACOBR6_01030) | - | 217707..218210 (+) | 504 | WP_420222889.1 | hypothetical protein | - |
| ACOBR6_RS01035 (ACOBR6_01035) | - | 218188..218406 (-) | 219 | WP_420222890.1 | hypothetical protein | - |
| ACOBR6_RS01040 (ACOBR6_01040) | - | 218509..218838 (-) | 330 | WP_420222891.1 | DUF771 domain-containing protein | - |
| ACOBR6_RS01045 (ACOBR6_01045) | - | 219284..219487 (-) | 204 | WP_420223143.1 | Thoeris anti-defense Tad2 family protein | - |
| ACOBR6_RS01050 (ACOBR6_01050) | - | 219586..220362 (-) | 777 | WP_420222893.1 | phage antirepressor | - |
| ACOBR6_RS01055 (ACOBR6_01055) | - | 220400..220585 (-) | 186 | WP_420223144.1 | hypothetical protein | - |
| ACOBR6_RS01060 (ACOBR6_01060) | - | 220897..221277 (+) | 381 | WP_420222895.1 | helix-turn-helix domain-containing protein | - |
| ACOBR6_RS01065 (ACOBR6_01065) | - | 221295..221711 (+) | 417 | WP_420222896.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACOBR6_RS01070 (ACOBR6_01070) | - | 221853..222071 (+) | 219 | WP_420222897.1 | hypothetical protein | - |
| ACOBR6_RS01075 (ACOBR6_01075) | - | 222143..222724 (+) | 582 | WP_420222898.1 | hypothetical protein | - |
| ACOBR6_RS01080 (ACOBR6_01080) | - | 223303..224436 (+) | 1134 | WP_420223145.1 | Abi family protein | - |
| ACOBR6_RS01085 (ACOBR6_01085) | - | 224676..224873 (+) | 198 | WP_214085118.1 | hypothetical protein | - |
| ACOBR6_RS01090 (ACOBR6_01090) | - | 225224..226006 (+) | 783 | WP_420222900.1 | AbiJ-NTD4 domain-containing protein | - |
| ACOBR6_RS01095 (ACOBR6_01095) | - | 226101..226862 (+) | 762 | WP_420222901.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ACOBR6_RS01100 (ACOBR6_01100) | - | 227138..228253 (+) | 1116 | WP_420222902.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17049.91 Da Isoelectric Point: 6.2359
>NTDB_id=1109015 ACOBR6_RS01025 WP_420222888.1 217106..217564(-) (ssb) [Pediococcus acidilactici strain HI5]
MINTVALVGRLTKDPEMRYTAAGVPVANFNLAVNRQFTNQNGEREADFINCLIWRKPAENFCDFTHKGSLVGISGRVQTR
SYTNQKDEKVYVTEVVAERFSLLESKEKDKSNSQPHSPVQESNQSKSKHTNPNDPFANGGQSIDITDDDLPF
MINTVALVGRLTKDPEMRYTAAGVPVANFNLAVNRQFTNQNGEREADFINCLIWRKPAENFCDFTHKGSLVGISGRVQTR
SYTNQKDEKVYVTEVVAERFSLLESKEKDKSNSQPHSPVQESNQSKSKHTNPNDPFANGGQSIDITDDDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=1109015 ACOBR6_RS01025 WP_420222888.1 217106..217564(-) (ssb) [Pediococcus acidilactici strain HI5]
TTGATTAATACAGTAGCATTAGTTGGTCGTTTAACAAAAGACCCAGAAATGAGATACACGGCAGCTGGTGTGCCAGTGGC
TAACTTTAACTTAGCCGTCAATCGACAATTTACAAACCAGAATGGAGAACGTGAAGCAGACTTTATTAACTGTTTGATTT
GGCGAAAACCAGCTGAAAACTTTTGTGATTTCACTCATAAAGGCTCATTAGTTGGTATTTCAGGAAGAGTACAGACCCGA
TCATATACCAATCAGAAAGATGAAAAAGTTTACGTTACCGAAGTTGTAGCAGAACGCTTTTCACTTTTAGAGTCCAAGGA
AAAAGACAAAAGCAATAGTCAACCACATAGTCCAGTACAAGAGAGTAACCAATCCAAGTCAAAGCATACTAATCCTAATG
ATCCGTTTGCAAATGGTGGGCAATCAATTGACATAACGGATGACGATTTACCGTTTTAA
TTGATTAATACAGTAGCATTAGTTGGTCGTTTAACAAAAGACCCAGAAATGAGATACACGGCAGCTGGTGTGCCAGTGGC
TAACTTTAACTTAGCCGTCAATCGACAATTTACAAACCAGAATGGAGAACGTGAAGCAGACTTTATTAACTGTTTGATTT
GGCGAAAACCAGCTGAAAACTTTTGTGATTTCACTCATAAAGGCTCATTAGTTGGTATTTCAGGAAGAGTACAGACCCGA
TCATATACCAATCAGAAAGATGAAAAAGTTTACGTTACCGAAGTTGTAGCAGAACGCTTTTCACTTTTAGAGTCCAAGGA
AAAAGACAAAAGCAATAGTCAACCACATAGTCCAGTACAAGAGAGTAACCAATCCAAGTCAAAGCATACTAATCCTAATG
ATCCGTTTGCAAATGGTGGGCAATCAATTGACATAACGGATGACGATTTACCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.618 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50 |
100 |
0.566 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.757 |
73.026 |
0.414 |