Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   V3C22_RS08570 Genome accession   NZ_CP183775
Coordinates   1746588..1746728 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain Xc     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1741588..1751728
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3C22_RS08540 (V3C22_08540) - 1742667..1742942 (-) 276 WP_002284750.1 Blp family class II bacteriocin -
  V3C22_RS08545 (V3C22_08545) - 1743246..1743380 (-) 135 WP_080062158.1 hypothetical protein -
  V3C22_RS08550 (V3C22_08550) - 1743838..1743999 (-) 162 WP_002295609.1 hypothetical protein -
  V3C22_RS08555 (V3C22_08555) - 1744244..1745272 (-) 1029 WP_002295608.1 thioredoxin family protein -
  V3C22_RS08560 (V3C22_08560) - 1745756..1745944 (-) 189 WP_002284747.1 Blp family class II bacteriocin -
  V3C22_RS08565 (V3C22_08565) - 1746108..1746321 (-) 214 Protein_1639 Blp family class II bacteriocin -
  V3C22_RS08570 (V3C22_08570) comC/blpC 1746588..1746728 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  V3C22_RS08575 (V3C22_08575) comD/blpH 1746881..1748200 (-) 1320 WP_226706881.1 GHKL domain-containing protein Regulator
  V3C22_RS08580 (V3C22_08580) comE/blpR 1748197..1748949 (-) 753 WP_002265454.1 response regulator transcription factor Regulator
  V3C22_RS08585 (V3C22_08585) - 1749414..1750052 (-) 639 WP_002267938.1 VTT domain-containing protein -
  V3C22_RS08590 (V3C22_08590) - 1750100..1750726 (-) 627 WP_002268642.1 hypothetical protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=1105964 V3C22_RS08570 WP_002270250.1 1746588..1746728(+) (comC/blpC) [Streptococcus mutans strain Xc]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1105964 V3C22_RS08570 WP_002270250.1 1746588..1746728(+) (comC/blpC) [Streptococcus mutans strain Xc]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978

Multiple sequence alignment