Detailed information
Overview
| Name | comC/blpC | Type | Regulator |
| Locus tag | V3C22_RS08570 | Genome accession | NZ_CP183775 |
| Coordinates | 1746588..1746728 (+) | Length | 46 a.a. |
| NCBI ID | WP_002270250.1 | Uniprot ID | Q9APK7 |
| Organism | Streptococcus mutans strain Xc | ||
| Function | binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1741588..1751728
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V3C22_RS08540 (V3C22_08540) | - | 1742667..1742942 (-) | 276 | WP_002284750.1 | Blp family class II bacteriocin | - |
| V3C22_RS08545 (V3C22_08545) | - | 1743246..1743380 (-) | 135 | WP_080062158.1 | hypothetical protein | - |
| V3C22_RS08550 (V3C22_08550) | - | 1743838..1743999 (-) | 162 | WP_002295609.1 | hypothetical protein | - |
| V3C22_RS08555 (V3C22_08555) | - | 1744244..1745272 (-) | 1029 | WP_002295608.1 | thioredoxin family protein | - |
| V3C22_RS08560 (V3C22_08560) | - | 1745756..1745944 (-) | 189 | WP_002284747.1 | Blp family class II bacteriocin | - |
| V3C22_RS08565 (V3C22_08565) | - | 1746108..1746321 (-) | 214 | Protein_1639 | Blp family class II bacteriocin | - |
| V3C22_RS08570 (V3C22_08570) | comC/blpC | 1746588..1746728 (+) | 141 | WP_002270250.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| V3C22_RS08575 (V3C22_08575) | comD/blpH | 1746881..1748200 (-) | 1320 | WP_226706881.1 | GHKL domain-containing protein | Regulator |
| V3C22_RS08580 (V3C22_08580) | comE/blpR | 1748197..1748949 (-) | 753 | WP_002265454.1 | response regulator transcription factor | Regulator |
| V3C22_RS08585 (V3C22_08585) | - | 1749414..1750052 (-) | 639 | WP_002267938.1 | VTT domain-containing protein | - |
| V3C22_RS08590 (V3C22_08590) | - | 1750100..1750726 (-) | 627 | WP_002268642.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5195.02 Da Isoelectric Point: 10.4929
>NTDB_id=1105964 V3C22_RS08570 WP_002270250.1 1746588..1746728(+) (comC/blpC) [Streptococcus mutans strain Xc]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
Nucleotide
Download Length: 141 bp
>NTDB_id=1105964 V3C22_RS08570 WP_002270250.1 1746588..1746728(+) (comC/blpC) [Streptococcus mutans strain Xc]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/blpC | Streptococcus mutans UA159 |
97.826 |
100 |
0.978 |