Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   V3C22_RS04360 Genome accession   NZ_CP183775
Coordinates   910655..911089 (+) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   A0AAX1K4B8
Organism   Streptococcus mutans strain Xc     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 876531..914639 910655..911089 within 0


Gene organization within MGE regions


Location: 876531..914639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3C22_RS04225 (V3C22_04225) - 876531..877664 (+) 1134 WP_002262876.1 ABC transporter ATP-binding protein -
  V3C22_RS04230 (V3C22_04230) dexB 877755..879365 (+) 1611 WP_226718792.1 glucan 1,6-alpha-glucosidase DexB -
  V3C22_RS04235 (V3C22_04235) - 879527..880525 (-) 999 WP_002302845.1 LacI family DNA-binding transcriptional regulator -
  V3C22_RS04240 (V3C22_04240) - 880668..881840 (+) 1173 WP_002262879.1 galactokinase -
  V3C22_RS04245 (V3C22_04245) galT 881845..883320 (+) 1476 WP_226709884.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  V3C22_RS04250 (V3C22_04250) galE 883469..884470 (+) 1002 WP_002307653.1 UDP-glucose 4-epimerase GalE -
  V3C22_RS04255 (V3C22_04255) - 884738..885817 (+) 1080 WP_002271491.1 serine hydrolase domain-containing protein -
  V3C22_RS04260 (V3C22_04260) - 886060..886563 (+) 504 WP_002269391.1 phosphatase PAP2 family protein -
  V3C22_RS04265 (V3C22_04265) - 886731..887336 (+) 606 WP_002307660.1 TetR/AcrR family transcriptional regulator -
  V3C22_RS04270 (V3C22_04270) - 887411..888127 (+) 717 WP_002284204.1 ABC transporter ATP-binding protein -
  V3C22_RS04275 (V3C22_04275) - 888114..889655 (+) 1542 WP_226718791.1 hypothetical protein -
  V3C22_RS04280 (V3C22_04280) - 889764..890138 (+) 375 WP_002262891.1 DUF1149 family protein -
  V3C22_RS04285 (V3C22_04285) - 890144..890989 (+) 846 WP_002266545.1 DegV family protein -
  V3C22_RS04290 (V3C22_04290) dapB 891001..891768 (+) 768 WP_002270312.1 4-hydroxy-tetrahydrodipicolinate reductase -
  V3C22_RS04295 (V3C22_04295) - 891765..892970 (+) 1206 WP_002300931.1 CCA tRNA nucleotidyltransferase -
  V3C22_RS04300 (V3C22_04300) - 892973..894841 (+) 1869 WP_226708950.1 ATP-binding cassette domain-containing protein -
  V3C22_RS04305 (V3C22_04305) - 895297..897033 (+) 1737 WP_002295432.1 ABC transporter ATP-binding protein -
  V3C22_RS04310 (V3C22_04310) - 897044..898816 (+) 1773 WP_226708951.1 ABC transporter transmembrane domain-containing protein -
  V3C22_RS04315 (V3C22_04315) - 898932..899852 (+) 921 WP_002295434.1 AEC family transporter -
  V3C22_RS04320 (V3C22_04320) gtfD 900073..904461 (+) 4389 WP_226708952.1 glucosyltransferase-S -
  V3C22_RS04325 (V3C22_04325) - 904685..905191 (-) 507 WP_226707182.1 DUF308 domain-containing protein -
  V3C22_RS04330 (V3C22_04330) gdhA 905836..907185 (+) 1350 WP_002302759.1 NADP-specific glutamate dehydrogenase -
  V3C22_RS04335 (V3C22_04335) - 907295..907678 (-) 384 WP_002281981.1 DUF3021 family protein -
  V3C22_RS04340 (V3C22_04340) queF 907787..908275 (-) 489 WP_002265143.1 preQ(1) synthase -
  V3C22_RS04345 (V3C22_04345) queE 908288..909004 (-) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  V3C22_RS04350 (V3C22_04350) queD 909001..909447 (-) 447 WP_002266457.1 6-carboxytetrahydropterin synthase QueD -
  V3C22_RS04355 (V3C22_04355) queC 909447..910100 (-) 654 WP_088741840.1 7-cyano-7-deazaguanine synthase QueC -
  V3C22_RS04360 (V3C22_04360) rcrR 910655..911089 (+) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  V3C22_RS04365 (V3C22_04365) rcrP 911093..912895 (+) 1803 WP_226718790.1 ATP-binding cassette domain-containing protein Regulator
  V3C22_RS04370 (V3C22_04370) rcrQ 912885..914639 (+) 1755 WP_002275251.1 ABC transporter ATP-binding protein Regulator

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=1105940 V3C22_RS04360 WP_002263292.1 910655..911089(+) (rcrR) [Streptococcus mutans strain Xc]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=1105940 V3C22_RS04360 WP_002263292.1 910655..911089(+) (rcrR) [Streptococcus mutans strain Xc]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGAAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(31-89)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

100

100

1

Multiple sequence alignment