Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACN2AT_RS12490 Genome accession   NZ_CP183238
Coordinates   2441416..2441589 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain NDmed     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2436416..2446589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN2AT_RS12475 (ACN2AT_12380) gcvT 2437215..2438303 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  ACN2AT_RS12480 (ACN2AT_12385) hepAA 2438745..2440418 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ACN2AT_RS12485 (ACN2AT_12390) yqhG 2440439..2441233 (+) 795 WP_003230200.1 YqhG family protein -
  ACN2AT_RS12490 (ACN2AT_12395) sinI 2441416..2441589 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACN2AT_RS12495 (ACN2AT_12400) sinR 2441623..2441958 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACN2AT_RS12500 (ACN2AT_12405) tasA 2442051..2442836 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACN2AT_RS12505 (ACN2AT_12410) sipW 2442900..2443472 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACN2AT_RS12510 (ACN2AT_12415) tapA 2443456..2444217 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACN2AT_RS12515 (ACN2AT_12420) yqzG 2444489..2444815 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACN2AT_RS12520 (ACN2AT_12425) spoIITA 2444857..2445036 (-) 180 WP_003230176.1 YqzE family protein -
  ACN2AT_RS12525 (ACN2AT_12430) comGG 2445107..2445481 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACN2AT_RS12530 (ACN2AT_12435) comGF 2445482..2445865 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACN2AT_RS12535 (ACN2AT_12440) comGE 2445891..2446238 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1104678 ACN2AT_RS12490 WP_003230187.1 2441416..2441589(+) (sinI) [Bacillus subtilis strain NDmed]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1104678 ACN2AT_RS12490 WP_003230187.1 2441416..2441589(+) (sinI) [Bacillus subtilis strain NDmed]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment