Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACNFKI_RS13560 Genome accession   NZ_CP182571
Coordinates   2718074..2718451 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain DY201     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2713074..2723451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNFKI_RS13520 (ACNFKI_13520) - 2713573..2714367 (+) 795 WP_003153106.1 YqhG family protein -
  ACNFKI_RS13525 (ACNFKI_13525) sinI 2714544..2714717 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNFKI_RS13530 (ACNFKI_13530) sinR 2714751..2715086 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNFKI_RS13535 (ACNFKI_13535) tasA 2715134..2715919 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACNFKI_RS13540 (ACNFKI_13540) sipW 2715983..2716567 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACNFKI_RS13545 (ACNFKI_13545) tapA 2716539..2717210 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  ACNFKI_RS13550 (ACNFKI_13550) - 2717469..2717798 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACNFKI_RS13555 (ACNFKI_13555) - 2717838..2718017 (-) 180 WP_003153093.1 YqzE family protein -
  ACNFKI_RS13560 (ACNFKI_13560) comGG 2718074..2718451 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNFKI_RS13565 (ACNFKI_13565) comGF 2718452..2718952 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  ACNFKI_RS13570 (ACNFKI_13570) comGE 2718861..2719175 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  ACNFKI_RS13575 (ACNFKI_13575) comGD 2719159..2719596 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACNFKI_RS13580 (ACNFKI_13580) comGC 2719586..2719894 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACNFKI_RS13585 (ACNFKI_13585) comGB 2719899..2720936 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACNFKI_RS13590 (ACNFKI_13590) comGA 2720923..2721993 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACNFKI_RS13595 (ACNFKI_13595) - 2722185..2723135 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=1102280 ACNFKI_RS13560 WP_003153092.1 2718074..2718451(-) (comGG) [Bacillus velezensis strain DY201]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1102280 ACNFKI_RS13560 WP_003153092.1 2718074..2718451(-) (comGG) [Bacillus velezensis strain DY201]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment