Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACNFKI_RS13525 Genome accession   NZ_CP182571
Coordinates   2714544..2714717 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain DY201     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2709544..2719717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNFKI_RS13510 (ACNFKI_13510) gcvT 2710361..2711461 (-) 1101 WP_303302216.1 glycine cleavage system aminomethyltransferase GcvT -
  ACNFKI_RS13515 (ACNFKI_13515) - 2711885..2713555 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACNFKI_RS13520 (ACNFKI_13520) - 2713573..2714367 (+) 795 WP_003153106.1 YqhG family protein -
  ACNFKI_RS13525 (ACNFKI_13525) sinI 2714544..2714717 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNFKI_RS13530 (ACNFKI_13530) sinR 2714751..2715086 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNFKI_RS13535 (ACNFKI_13535) tasA 2715134..2715919 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACNFKI_RS13540 (ACNFKI_13540) sipW 2715983..2716567 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACNFKI_RS13545 (ACNFKI_13545) tapA 2716539..2717210 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  ACNFKI_RS13550 (ACNFKI_13550) - 2717469..2717798 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACNFKI_RS13555 (ACNFKI_13555) - 2717838..2718017 (-) 180 WP_003153093.1 YqzE family protein -
  ACNFKI_RS13560 (ACNFKI_13560) comGG 2718074..2718451 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNFKI_RS13565 (ACNFKI_13565) comGF 2718452..2718952 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  ACNFKI_RS13570 (ACNFKI_13570) comGE 2718861..2719175 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  ACNFKI_RS13575 (ACNFKI_13575) comGD 2719159..2719596 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1102278 ACNFKI_RS13525 WP_003153105.1 2714544..2714717(+) (sinI) [Bacillus velezensis strain DY201]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1102278 ACNFKI_RS13525 WP_003153105.1 2714544..2714717(+) (sinI) [Bacillus velezensis strain DY201]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment