Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACNFKI_RS13525 | Genome accession | NZ_CP182571 |
| Coordinates | 2714544..2714717 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain DY201 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2709544..2719717
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACNFKI_RS13510 (ACNFKI_13510) | gcvT | 2710361..2711461 (-) | 1101 | WP_303302216.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACNFKI_RS13515 (ACNFKI_13515) | - | 2711885..2713555 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACNFKI_RS13520 (ACNFKI_13520) | - | 2713573..2714367 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACNFKI_RS13525 (ACNFKI_13525) | sinI | 2714544..2714717 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACNFKI_RS13530 (ACNFKI_13530) | sinR | 2714751..2715086 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACNFKI_RS13535 (ACNFKI_13535) | tasA | 2715134..2715919 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACNFKI_RS13540 (ACNFKI_13540) | sipW | 2715983..2716567 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| ACNFKI_RS13545 (ACNFKI_13545) | tapA | 2716539..2717210 (-) | 672 | WP_046559874.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACNFKI_RS13550 (ACNFKI_13550) | - | 2717469..2717798 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACNFKI_RS13555 (ACNFKI_13555) | - | 2717838..2718017 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACNFKI_RS13560 (ACNFKI_13560) | comGG | 2718074..2718451 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACNFKI_RS13565 (ACNFKI_13565) | comGF | 2718452..2718952 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| ACNFKI_RS13570 (ACNFKI_13570) | comGE | 2718861..2719175 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| ACNFKI_RS13575 (ACNFKI_13575) | comGD | 2719159..2719596 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1102278 ACNFKI_RS13525 WP_003153105.1 2714544..2714717(+) (sinI) [Bacillus velezensis strain DY201]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1102278 ACNFKI_RS13525 WP_003153105.1 2714544..2714717(+) (sinI) [Bacillus velezensis strain DY201]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |