Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ACM1PH_RS03890 Genome accession   NZ_CP181055
Coordinates   719326..719769 (-) Length   147 a.a.
NCBI ID   WP_416144932.1    Uniprot ID   -
Organism   Planococcus koreensis strain OC-PG-Soil     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 681232..730750 719326..719769 within 0


Gene organization within MGE regions


Location: 681232..730750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM1PH_RS03665 (ACM1PH_03665) topA 681232..683300 (-) 2069 Protein_730 type I DNA topoisomerase -
  ACM1PH_RS03670 (ACM1PH_03670) - 683420..684298 (-) 879 WP_416144888.1 DNA-processing protein DprA -
  ACM1PH_RS03675 (ACM1PH_03675) - 684732..684914 (+) 183 WP_416144889.1 hypothetical protein -
  ACM1PH_RS03680 (ACM1PH_03680) - 684949..686814 (-) 1866 WP_416144890.1 hypothetical protein -
  ACM1PH_RS03685 (ACM1PH_03685) - 686871..687326 (-) 456 WP_416144891.1 Panacea domain-containing protein -
  ACM1PH_RS03690 (ACM1PH_03690) - 687559..688428 (-) 870 WP_416144892.1 N-acetylmuramoyl-L-alanine amidase -
  ACM1PH_RS03695 (ACM1PH_03695) - 688429..688707 (-) 279 WP_416144893.1 holin -
  ACM1PH_RS03700 (ACM1PH_03700) - 688704..689222 (-) 519 WP_416144894.1 holin family protein -
  ACM1PH_RS03705 (ACM1PH_03705) - 689424..689570 (-) 147 WP_416144895.1 hypothetical protein -
  ACM1PH_RS03710 (ACM1PH_03710) - 690430..690558 (-) 129 WP_416144896.1 hypothetical protein -
  ACM1PH_RS03715 (ACM1PH_03715) - 690597..690920 (-) 324 WP_416144897.1 hypothetical protein -
  ACM1PH_RS03720 (ACM1PH_03720) - 690935..691366 (-) 432 WP_416144898.1 hypothetical protein -
  ACM1PH_RS03725 (ACM1PH_03725) - 691387..695316 (-) 3930 WP_416144899.1 phage tail spike protein -
  ACM1PH_RS03730 (ACM1PH_03730) - 695313..696779 (-) 1467 WP_416144900.1 distal tail protein Dit -
  ACM1PH_RS03735 (ACM1PH_03735) - 696781..700038 (-) 3258 WP_416144901.1 hypothetical protein -
  ACM1PH_RS03740 (ACM1PH_03740) - 700042..700497 (-) 456 WP_416144902.1 hypothetical protein -
  ACM1PH_RS03745 (ACM1PH_03745) - 700386..700832 (-) 447 WP_416144903.1 tail assembly chaperone -
  ACM1PH_RS03750 (ACM1PH_03750) - 700912..701439 (-) 528 WP_416144904.1 phage major tail protein, TP901-1 family -
  ACM1PH_RS03755 (ACM1PH_03755) - 701456..701863 (-) 408 WP_416144905.1 DUF3168 domain-containing protein -
  ACM1PH_RS03760 (ACM1PH_03760) - 701864..702289 (-) 426 WP_416144906.1 HK97 gp10 family phage protein -
  ACM1PH_RS03765 (ACM1PH_03765) - 702282..702608 (-) 327 WP_416144907.1 phage head closure protein -
  ACM1PH_RS03770 (ACM1PH_03770) - 702595..702948 (-) 354 WP_416144908.1 phage head-tail connector protein -
  ACM1PH_RS03775 (ACM1PH_03775) - 702958..703353 (-) 396 WP_416144909.1 hypothetical protein -
  ACM1PH_RS03780 (ACM1PH_03780) - 703373..704395 (-) 1023 WP_416144910.1 major capsid protein -
  ACM1PH_RS03785 (ACM1PH_03785) - 704426..704734 (-) 309 WP_416144911.1 hypothetical protein -
  ACM1PH_RS03790 (ACM1PH_03790) - 704750..705346 (-) 597 WP_416144912.1 DUF4355 domain-containing protein -
  ACM1PH_RS03795 (ACM1PH_03795) - 705680..705973 (-) 294 WP_416144913.1 hypothetical protein -
  ACM1PH_RS03800 (ACM1PH_03800) - 705992..707353 (-) 1362 WP_416144914.1 hypothetical protein -
  ACM1PH_RS03805 (ACM1PH_03805) - 707350..708864 (-) 1515 WP_416144915.1 phage portal protein -
  ACM1PH_RS03810 (ACM1PH_03810) - 708874..710073 (-) 1200 WP_416144916.1 PBSX family phage terminase large subunit -
  ACM1PH_RS03815 (ACM1PH_03815) - 710048..710800 (-) 753 WP_416144917.1 hypothetical protein -
  ACM1PH_RS03820 (ACM1PH_03820) - 710916..711077 (+) 162 WP_416144918.1 hypothetical protein -
  ACM1PH_RS03825 (ACM1PH_03825) - 711115..711399 (-) 285 WP_416144919.1 ImmA/IrrE family metallo-endopeptidase -
  ACM1PH_RS03830 (ACM1PH_03830) - 711489..711779 (-) 291 WP_416144920.1 hypothetical protein -
  ACM1PH_RS03835 (ACM1PH_03835) - 711773..712165 (-) 393 WP_416144921.1 hypothetical protein -
  ACM1PH_RS03840 (ACM1PH_03840) - 712397..712792 (-) 396 WP_416144922.1 helix-turn-helix transcriptional regulator -
  ACM1PH_RS03845 (ACM1PH_03845) - 713088..714326 (-) 1239 WP_416144923.1 putative phage abortive infection protein -
  ACM1PH_RS03850 (ACM1PH_03850) - 714640..715152 (-) 513 WP_416144924.1 hypothetical protein -
  ACM1PH_RS03855 (ACM1PH_03855) - 715242..716330 (-) 1089 WP_416144925.1 MrcB family domain-containing protein -
  ACM1PH_RS03860 (ACM1PH_03860) - 716327..716524 (-) 198 WP_416144926.1 XtrA/YqaO family protein -
  ACM1PH_RS03865 (ACM1PH_03865) - 716607..717173 (+) 567 WP_416144927.1 hypothetical protein -
  ACM1PH_RS03870 (ACM1PH_03870) - 717218..717640 (-) 423 WP_416144928.1 RusA family crossover junction endodeoxyribonuclease -
  ACM1PH_RS03875 (ACM1PH_03875) - 717651..717782 (-) 132 WP_416144929.1 hypothetical protein -
  ACM1PH_RS03880 (ACM1PH_03880) - 718521..718817 (-) 297 WP_416144930.1 hypothetical protein -
  ACM1PH_RS03885 (ACM1PH_03885) - 718939..719148 (-) 210 WP_416144931.1 hypothetical protein -
  ACM1PH_RS03890 (ACM1PH_03890) ssbA 719326..719769 (-) 444 WP_416144932.1 single-stranded DNA-binding protein Machinery gene
  ACM1PH_RS03895 (ACM1PH_03895) - 719766..720329 (-) 564 WP_416144933.1 hypothetical protein -
  ACM1PH_RS03900 (ACM1PH_03900) - 720326..720505 (-) 180 WP_416144934.1 hypothetical protein -
  ACM1PH_RS03905 (ACM1PH_03905) - 720520..721314 (-) 795 WP_416144935.1 ATP-binding protein -
  ACM1PH_RS03910 (ACM1PH_03910) - 721283..722188 (-) 906 WP_416144936.1 DnaD domain-containing protein -
  ACM1PH_RS03915 (ACM1PH_03915) - 722247..723053 (-) 807 WP_416144937.1 PD-(D/E)XK nuclease-like domain-containing protein -
  ACM1PH_RS03920 (ACM1PH_03920) - 723001..723921 (-) 921 WP_416144938.1 hypothetical protein -
  ACM1PH_RS03925 (ACM1PH_03925) - 724026..724244 (-) 219 WP_416144939.1 hypothetical protein -
  ACM1PH_RS03930 (ACM1PH_03930) - 724446..724676 (-) 231 WP_416144940.1 hypothetical protein -
  ACM1PH_RS03935 (ACM1PH_03935) - 724942..725064 (-) 123 WP_416144941.1 hypothetical protein -
  ACM1PH_RS03940 (ACM1PH_03940) - 725061..725576 (-) 516 WP_416144942.1 helix-turn-helix domain-containing protein -
  ACM1PH_RS03945 (ACM1PH_03945) - 725663..725968 (-) 306 WP_416144943.1 helix-turn-helix domain-containing protein -
  ACM1PH_RS03950 (ACM1PH_03950) - 726035..726163 (-) 129 WP_416144944.1 hypothetical protein -
  ACM1PH_RS03955 (ACM1PH_03955) - 726190..726963 (-) 774 WP_416144945.1 phage antirepressor -
  ACM1PH_RS03960 (ACM1PH_03960) - 727101..727307 (+) 207 WP_416144946.1 KTSC domain-containing protein -
  ACM1PH_RS03965 (ACM1PH_03965) - 727304..727459 (-) 156 WP_416144947.1 BC1881 family protein -
  ACM1PH_RS03970 (ACM1PH_03970) - 727460..727666 (-) 207 WP_416144948.1 hypothetical protein -
  ACM1PH_RS03975 (ACM1PH_03975) - 727683..727910 (-) 228 WP_416144949.1 helix-turn-helix transcriptional regulator -
  ACM1PH_RS03980 (ACM1PH_03980) - 728061..728414 (+) 354 WP_416144950.1 helix-turn-helix domain-containing protein -
  ACM1PH_RS03985 (ACM1PH_03985) - 728445..728690 (+) 246 WP_416144951.1 hypothetical protein -
  ACM1PH_RS03990 (ACM1PH_03990) - 728790..729251 (+) 462 WP_416144952.1 ImmA/IrrE family metallo-endopeptidase -
  ACM1PH_RS03995 (ACM1PH_03995) - 729264..729452 (+) 189 WP_416144953.1 hypothetical protein -
  ACM1PH_RS04000 (ACM1PH_04000) - 729557..730750 (+) 1194 WP_416144954.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 147 a.a.        Molecular weight: 16325.20 Da        Isoelectric Point: 5.0347

>NTDB_id=1097947 ACM1PH_RS03890 WP_416144932.1 719326..719769(-) (ssbA) [Planococcus koreensis strain OC-PG-Soil]
MINRVIMVGRLTKDPDLKYTPTGAAVARFTLAVNRNFSNAQGEKETDFINCTVWRKQAENTANFFKKGSLAGIEGRIQTG
SYEGTDGKRVYTTEVVADSVQFLEPKNSAPKTEERSEAPPEKTREPKVFNGTDISYTGPDPEDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=1097947 ACM1PH_RS03890 WP_416144932.1 719326..719769(-) (ssbA) [Planococcus koreensis strain OC-PG-Soil]
ATGATCAACCGAGTAATCATGGTCGGGAGACTCACAAAGGATCCAGATTTAAAATACACGCCAACAGGTGCGGCGGTAGC
CAGATTCACATTGGCAGTTAATCGGAATTTCTCCAATGCACAGGGCGAAAAAGAAACGGACTTTATCAATTGTACCGTAT
GGCGAAAACAAGCTGAGAATACGGCTAACTTCTTCAAAAAGGGAAGCTTGGCTGGCATTGAGGGACGCATACAGACTGGA
AGCTATGAAGGAACTGATGGAAAACGTGTCTACACAACGGAAGTAGTCGCTGACAGTGTTCAATTCTTAGAGCCAAAGAA
CAGCGCACCAAAAACAGAAGAACGTTCAGAAGCACCGCCAGAAAAGACGAGAGAACCAAAGGTTTTCAATGGCACAGACA
TCAGCTATACCGGTCCAGACCCGGAGGACGATTTACCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

71.028

72.789

0.517
  ssb Latilactobacillus sakei subsp. sakei 23K

51.02

100

0.51
  ssbB Bacillus subtilis subsp. subtilis str. 168

65.094

72.109

0.469

Multiple sequence alignment