Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACMX2G_RS01370 Genome accession   NZ_CP180375
Coordinates   297847..298020 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain NJN-6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 292847..303020
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX2G_RS01355 (ACMX2G_01355) gcvT 293665..294765 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  ACMX2G_RS01360 (ACMX2G_01360) - 295188..296858 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACMX2G_RS01365 (ACMX2G_01365) - 296876..297670 (+) 795 WP_003153106.1 YqhG family protein -
  ACMX2G_RS01370 (ACMX2G_01370) sinI 297847..298020 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACMX2G_RS01375 (ACMX2G_01375) sinR 298054..298389 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACMX2G_RS01380 (ACMX2G_01380) tasA 298437..299222 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  ACMX2G_RS01385 (ACMX2G_01385) sipW 299286..299870 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACMX2G_RS01390 (ACMX2G_01390) tapA 299842..300513 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACMX2G_RS01395 (ACMX2G_01395) - 300773..301102 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  ACMX2G_RS01400 (ACMX2G_01400) - 301142..301321 (-) 180 WP_003153093.1 YqzE family protein -
  ACMX2G_RS01405 (ACMX2G_01405) comGG 301378..301755 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACMX2G_RS01410 (ACMX2G_01410) comGF 301756..302151 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  ACMX2G_RS01415 (ACMX2G_01415) comGE 302165..302479 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACMX2G_RS01420 (ACMX2G_01420) comGD 302463..302900 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1095445 ACMX2G_RS01370 WP_003153105.1 297847..298020(+) (sinI) [Bacillus velezensis strain NJN-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1095445 ACMX2G_RS01370 WP_003153105.1 297847..298020(+) (sinI) [Bacillus velezensis strain NJN-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment