Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACMX2G_RS01370 | Genome accession | NZ_CP180375 |
| Coordinates | 297847..298020 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain NJN-6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 292847..303020
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACMX2G_RS01355 (ACMX2G_01355) | gcvT | 293665..294765 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACMX2G_RS01360 (ACMX2G_01360) | - | 295188..296858 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACMX2G_RS01365 (ACMX2G_01365) | - | 296876..297670 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACMX2G_RS01370 (ACMX2G_01370) | sinI | 297847..298020 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACMX2G_RS01375 (ACMX2G_01375) | sinR | 298054..298389 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACMX2G_RS01380 (ACMX2G_01380) | tasA | 298437..299222 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| ACMX2G_RS01385 (ACMX2G_01385) | sipW | 299286..299870 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| ACMX2G_RS01390 (ACMX2G_01390) | tapA | 299842..300513 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACMX2G_RS01395 (ACMX2G_01395) | - | 300773..301102 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| ACMX2G_RS01400 (ACMX2G_01400) | - | 301142..301321 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACMX2G_RS01405 (ACMX2G_01405) | comGG | 301378..301755 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACMX2G_RS01410 (ACMX2G_01410) | comGF | 301756..302151 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| ACMX2G_RS01415 (ACMX2G_01415) | comGE | 302165..302479 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACMX2G_RS01420 (ACMX2G_01420) | comGD | 302463..302900 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1095445 ACMX2G_RS01370 WP_003153105.1 297847..298020(+) (sinI) [Bacillus velezensis strain NJN-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1095445 ACMX2G_RS01370 WP_003153105.1 297847..298020(+) (sinI) [Bacillus velezensis strain NJN-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |