Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACMX2G_RS01415 Genome accession   NZ_CP180375
Coordinates   302165..302479 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain NJN-6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 297165..307479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX2G_RS01370 (ACMX2G_01370) sinI 297847..298020 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACMX2G_RS01375 (ACMX2G_01375) sinR 298054..298389 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACMX2G_RS01380 (ACMX2G_01380) tasA 298437..299222 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  ACMX2G_RS01385 (ACMX2G_01385) sipW 299286..299870 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACMX2G_RS01390 (ACMX2G_01390) tapA 299842..300513 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACMX2G_RS01395 (ACMX2G_01395) - 300773..301102 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  ACMX2G_RS01400 (ACMX2G_01400) - 301142..301321 (-) 180 WP_003153093.1 YqzE family protein -
  ACMX2G_RS01405 (ACMX2G_01405) comGG 301378..301755 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACMX2G_RS01410 (ACMX2G_01410) comGF 301756..302151 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  ACMX2G_RS01415 (ACMX2G_01415) comGE 302165..302479 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACMX2G_RS01420 (ACMX2G_01420) comGD 302463..302900 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACMX2G_RS01425 (ACMX2G_01425) comGC 302890..303156 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACMX2G_RS01430 (ACMX2G_01430) comGB 303203..304240 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACMX2G_RS01435 (ACMX2G_01435) comGA 304227..305297 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACMX2G_RS01440 (ACMX2G_01440) - 305489..306439 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1095448 ACMX2G_RS01415 WP_015388003.1 302165..302479(-) (comGE) [Bacillus velezensis strain NJN-6]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1095448 ACMX2G_RS01415 WP_015388003.1 302165..302479(-) (comGE) [Bacillus velezensis strain NJN-6]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment