Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACMU92_RS04220 Genome accession   NZ_CP180278
Coordinates   816767..817249 (+) Length   160 a.a.
NCBI ID   WP_415380212.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain K6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 806787..850292 816767..817249 within 0


Gene organization within MGE regions


Location: 806787..850292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMU92_RS04135 - 806787..807959 (-) 1173 WP_415380187.1 tyrosine-type recombinase/integrase -
  ACMU92_RS04140 - 808206..809171 (-) 966 WP_415380189.1 Abi family protein -
  ACMU92_RS04145 - 809287..809700 (-) 414 WP_415380191.1 hypothetical protein -
  ACMU92_RS04150 - 809782..810246 (-) 465 WP_251974212.1 hypothetical protein -
  ACMU92_RS04155 - 810325..810717 (-) 393 WP_415380194.1 ImmA/IrrE family metallo-endopeptidase -
  ACMU92_RS04160 - 810724..811047 (-) 324 WP_146419242.1 helix-turn-helix domain-containing protein -
  ACMU92_RS04165 - 811191..811412 (+) 222 WP_415380196.1 helix-turn-helix domain-containing protein -
  ACMU92_RS04170 - 811409..811570 (+) 162 WP_159270418.1 hypothetical protein -
  ACMU92_RS04175 - 811558..811830 (-) 273 WP_159270419.1 hypothetical protein -
  ACMU92_RS04180 - 811898..812119 (+) 222 WP_415380199.1 hypothetical protein -
  ACMU92_RS04185 - 812193..812651 (+) 459 WP_239961055.1 helix-turn-helix domain-containing protein -
  ACMU92_RS04190 - 812652..812927 (+) 276 WP_415380201.1 helix-turn-helix domain-containing protein -
  ACMU92_RS04195 - 813165..813446 (+) 282 WP_141822573.1 hypothetical protein -
  ACMU92_RS04200 bet 813439..814203 (+) 765 WP_415380204.1 phage recombination protein Bet -
  ACMU92_RS04205 - 814163..815008 (+) 846 WP_415380206.1 PD-(D/E)XK nuclease-like domain-containing protein -
  ACMU92_RS04210 - 815019..815894 (+) 876 WP_415380208.1 helix-turn-helix domain-containing protein -
  ACMU92_RS04215 - 815898..816593 (+) 696 WP_415380210.1 putative HNHc nuclease -
  ACMU92_RS04220 ssb 816767..817249 (+) 483 WP_415380212.1 single-stranded DNA-binding protein Machinery gene
  ACMU92_RS04225 - 817398..817715 (+) 318 WP_415380214.1 DeoR family transcriptional regulator -
  ACMU92_RS04230 - 817718..817888 (+) 171 WP_415380216.1 hypothetical protein -
  ACMU92_RS04235 - 817878..818051 (+) 174 WP_415380218.1 hypothetical protein -
  ACMU92_RS04240 - 818051..818227 (+) 177 WP_415380220.1 hypothetical protein -
  ACMU92_RS04245 - 818382..818624 (+) 243 WP_195753226.1 hypothetical protein -
  ACMU92_RS04250 - 818996..819439 (+) 444 WP_094104548.1 hypothetical protein -
  ACMU92_RS04260 - 819886..820170 (+) 285 WP_415380222.1 hypothetical protein -
  ACMU92_RS04265 - 820207..820380 (+) 174 WP_329504023.1 hypothetical protein -
  ACMU92_RS04270 - 820380..820880 (+) 501 WP_146419224.1 terminase small subunit -
  ACMU92_RS04275 - 820877..822253 (+) 1377 WP_415380225.1 PBSX family phage terminase large subunit -
  ACMU92_RS04280 - 822321..823874 (+) 1554 WP_415380227.1 phage portal protein -
  ACMU92_RS04285 - 823874..825940 (+) 2067 WP_415380229.1 phage minor capsid protein -
  ACMU92_RS04290 - 825940..826170 (+) 231 WP_415380231.1 hypothetical protein -
  ACMU92_RS04295 - 826265..826903 (+) 639 WP_415380232.1 phage scaffolding protein -
  ACMU92_RS04300 - 826924..827985 (+) 1062 WP_415380234.1 replication protein -
  ACMU92_RS04305 - 828141..828545 (+) 405 WP_415380236.1 hypothetical protein -
  ACMU92_RS04310 - 828569..828925 (+) 357 WP_161506388.1 putative minor capsid protein -
  ACMU92_RS04315 - 828926..829306 (+) 381 WP_322164360.1 minor capsid protein -
  ACMU92_RS04320 - 829303..829704 (+) 402 WP_415380238.1 hypothetical protein -
  ACMU92_RS04325 - 829719..830519 (+) 801 WP_415380240.1 phage tail tube protein -
  ACMU92_RS04330 - 830609..831115 (+) 507 WP_415380242.1 hypothetical protein -
  ACMU92_RS04335 - 831127..831741 (+) 615 WP_322164364.1 Gp15 family bacteriophage protein -
  ACMU92_RS04340 - 831744..836546 (+) 4803 WP_415380244.1 tape measure protein -
  ACMU92_RS04345 - 836546..838723 (+) 2178 WP_415380246.1 distal tail protein Dit -
  ACMU92_RS04350 - 839215..841257 (+) 2043 WP_415380248.1 phage tail spike protein -
  ACMU92_RS04355 - 841258..843093 (+) 1836 WP_415380250.1 hypothetical protein -
  ACMU92_RS04360 - 843090..843320 (+) 231 WP_415380252.1 hypothetical protein -
  ACMU92_RS04365 - 843310..843486 (+) 177 WP_415380254.1 hypothetical protein -
  ACMU92_RS04370 - 843500..843748 (+) 249 WP_415380256.1 hypothetical protein -
  ACMU92_RS04375 - 844074..844313 (+) 240 WP_415380258.1 phage holin -
  ACMU92_RS04380 - 844297..845427 (+) 1131 WP_415380260.1 peptidoglycan recognition family protein -
  ACMU92_RS04385 - 846455..847144 (+) 690 WP_160208394.1 hypothetical protein -
  ACMU92_RS04390 - 847147..848286 (+) 1140 WP_415380263.1 ImmA/IrrE family metallo-endopeptidase -
  ACMU92_RS04395 - 848916..850292 (+) 1377 WP_201626886.1 amino acid permease -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 18165.88 Da        Isoelectric Point: 6.9538

>NTDB_id=1095028 ACMU92_RS04220 WP_415380212.1 816767..817249(+) (ssb) [Pediococcus pentosaceus strain K6]
MINRTVLVGRLTNDPELKYTGNGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKPAENFCNFTHKGSLVGIDGRIQTR
SYDNQQGTRVFVTEVVAENFSLLESKNSNQNNQSEQFGQNRPQNNGKNYQNQQNGQSSPNRNPNDPFNSMPDIKDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=1095028 ACMU92_RS04220 WP_415380212.1 816767..817249(+) (ssb) [Pediococcus pentosaceus strain K6]
ATGATTAATCGAACAGTATTAGTCGGGCGCTTAACTAACGATCCAGAACTAAAATACACCGGCAATGGTGTAGCAGTTGC
AACTTTTACAGTAGCTGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCGGATTTTATTAGATGCCAAATGT
GGCGTAAACCTGCTGAAAATTTTTGTAACTTTACTCACAAGGGTTCACTAGTTGGCATTGACGGACGGATTCAGACTCGT
TCATACGATAATCAACAAGGAACACGAGTTTTTGTTACTGAGGTCGTAGCTGAGAACTTCTCGCTACTTGAATCTAAAAA
CAGCAATCAAAATAACCAAAGTGAACAATTTGGACAAAATAGACCTCAAAATAATGGAAAAAATTACCAGAATCAACAAA
ATGGTCAATCATCACCTAATAGAAATCCTAACGACCCATTTAATAGCATGCCGGATATCAAGGATGACGATTTACCGTTC
TAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.471

100

0.625
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.322

100

0.613
  ssbB Bacillus subtilis subsp. subtilis str. 168

55.66

66.25

0.369

Multiple sequence alignment