Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ACMGFB_RS05205 Genome accession   NZ_CP179724
Coordinates   976905..977417 (-) Length   170 a.a.
NCBI ID   WP_414049810.1    Uniprot ID   -
Organism   Macrococcus sp. 21M1142     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 938320..992194 976905..977417 within 0


Gene organization within MGE regions


Location: 938320..992194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMGFB_RS04960 (ACMGFB_04960) - 938320..938928 (-) 609 WP_414049761.1 LysM peptidoglycan-binding domain-containing protein -
  ACMGFB_RS04965 (ACMGFB_04965) - 938970..939581 (-) 612 WP_414049762.1 N-acetylmuramoyl-L-alanine amidase -
  ACMGFB_RS04970 (ACMGFB_04970) - 939583..939960 (-) 378 WP_414049763.1 phage holin -
  ACMGFB_RS04975 (ACMGFB_04975) - 940008..940448 (-) 441 WP_414049764.1 hypothetical protein -
  ACMGFB_RS04980 (ACMGFB_04980) - 940453..940713 (-) 261 WP_414049765.1 hypothetical protein -
  ACMGFB_RS04985 (ACMGFB_04985) - 940826..942688 (-) 1863 WP_414049766.1 GDSL-type esterase/lipase family protein -
  ACMGFB_RS04990 (ACMGFB_04990) - 942703..946647 (-) 3945 WP_414049767.1 Ig-like domain-containing protein -
  ACMGFB_RS04995 (ACMGFB_04995) - 946696..946974 (-) 279 WP_414049768.1 hypothetical protein -
  ACMGFB_RS05000 (ACMGFB_05000) - 946987..949116 (-) 2130 WP_414049769.1 phage tail spike protein -
  ACMGFB_RS05005 (ACMGFB_05005) - 949116..949550 (-) 435 WP_414049770.1 hypothetical protein -
  ACMGFB_RS05010 (ACMGFB_05010) - 949540..956616 (-) 7077 WP_414049771.1 LysM peptidoglycan-binding domain-containing protein -
  ACMGFB_RS05015 (ACMGFB_05015) - 956657..957040 (-) 384 WP_414049772.1 hypothetical protein -
  ACMGFB_RS05020 (ACMGFB_05020) - 956992..957516 (-) 525 WP_414049773.1 hypothetical protein -
  ACMGFB_RS05025 (ACMGFB_05025) - 957601..958191 (-) 591 WP_414049774.1 hypothetical protein -
  ACMGFB_RS05030 (ACMGFB_05030) - 958244..958672 (-) 429 WP_414049775.1 hypothetical protein -
  ACMGFB_RS05035 (ACMGFB_05035) - 958672..959157 (-) 486 WP_414049776.1 HK97 gp10 family phage protein -
  ACMGFB_RS05040 (ACMGFB_05040) - 959147..959491 (-) 345 WP_414049777.1 hypothetical protein -
  ACMGFB_RS05045 (ACMGFB_05045) - 959491..959856 (-) 366 WP_414049778.1 hypothetical protein -
  ACMGFB_RS05050 (ACMGFB_05050) - 959871..960143 (-) 273 WP_414049779.1 E3 binding domain-containing protein -
  ACMGFB_RS05055 (ACMGFB_05055) - 960182..961186 (-) 1005 WP_414049780.1 major capsid protein E -
  ACMGFB_RS05060 (ACMGFB_05060) - 961213..961587 (-) 375 WP_414049781.1 hypothetical protein -
  ACMGFB_RS05065 (ACMGFB_05065) - 961599..962201 (-) 603 WP_414049782.1 phage scaffolding protein -
  ACMGFB_RS05070 (ACMGFB_05070) - 962479..962625 (+) 147 WP_414049783.1 hypothetical protein -
  ACMGFB_RS05075 (ACMGFB_05075) - 962637..962957 (-) 321 WP_414049784.1 hypothetical protein -
  ACMGFB_RS05080 (ACMGFB_05080) - 963016..963237 (-) 222 WP_414049785.1 hypothetical protein -
  ACMGFB_RS05085 (ACMGFB_05085) - 963227..964870 (-) 1644 WP_414049786.1 phage minor capsid protein -
  ACMGFB_RS05090 (ACMGFB_05090) - 964874..965011 (-) 138 WP_414049787.1 hypothetical protein -
  ACMGFB_RS05095 (ACMGFB_05095) - 964998..966641 (-) 1644 WP_414049788.1 hypothetical protein -
  ACMGFB_RS05100 (ACMGFB_05100) terL 966653..968047 (-) 1395 WP_414049789.1 phage terminase large subunit -
  ACMGFB_RS05105 (ACMGFB_05105) - 968049..968474 (-) 426 WP_414049790.1 terminase small subunit -
  ACMGFB_RS05110 (ACMGFB_05110) - 968557..968721 (-) 165 WP_414049791.1 hypothetical protein -
  ACMGFB_RS05115 (ACMGFB_05115) - 968983..969576 (-) 594 WP_414049792.1 hypothetical protein -
  ACMGFB_RS05120 (ACMGFB_05120) - 969612..970016 (-) 405 WP_414049793.1 hypothetical protein -
  ACMGFB_RS05125 (ACMGFB_05125) - 970020..970466 (-) 447 WP_414049794.1 Holliday junction resolvase RecU -
  ACMGFB_RS05130 (ACMGFB_05130) - 970498..971025 (-) 528 WP_414049795.1 hypothetical protein -
  ACMGFB_RS05135 (ACMGFB_05135) - 971084..971668 (-) 585 WP_414049796.1 dUTP diphosphatase -
  ACMGFB_RS05140 (ACMGFB_05140) - 971684..971836 (-) 153 WP_414049797.1 hypothetical protein -
  ACMGFB_RS05145 (ACMGFB_05145) - 971862..972047 (-) 186 WP_414049798.1 hypothetical protein -
  ACMGFB_RS05150 (ACMGFB_05150) - 972049..972468 (-) 420 WP_414049799.1 YopX family protein -
  ACMGFB_RS05155 (ACMGFB_05155) - 972704..973045 (-) 342 WP_414049800.1 hypothetical protein -
  ACMGFB_RS05160 (ACMGFB_05160) - 973206..973661 (-) 456 WP_414049801.1 class I SAM-dependent methyltransferase -
  ACMGFB_RS05165 (ACMGFB_05165) - 973658..974107 (-) 450 WP_414049802.1 hypothetical protein -
  ACMGFB_RS05170 (ACMGFB_05170) - 974104..974268 (-) 165 WP_414049803.1 hypothetical protein -
  ACMGFB_RS05175 (ACMGFB_05175) - 974268..974510 (-) 243 WP_414049804.1 hypothetical protein -
  ACMGFB_RS05180 (ACMGFB_05180) - 974470..975702 (-) 1233 WP_414049805.1 DUF3310 domain-containing protein -
  ACMGFB_RS05185 (ACMGFB_05185) - 975704..975931 (-) 228 WP_414049806.1 helix-turn-helix domain-containing protein -
  ACMGFB_RS05190 (ACMGFB_05190) - 975979..976380 (-) 402 WP_414049807.1 hypothetical protein -
  ACMGFB_RS05195 (ACMGFB_05195) - 976395..976616 (-) 222 WP_414049808.1 hypothetical protein -
  ACMGFB_RS05200 (ACMGFB_05200) - 976692..976892 (-) 201 WP_414049809.1 hypothetical protein -
  ACMGFB_RS05205 (ACMGFB_05205) ssbA 976905..977417 (-) 513 WP_414049810.1 single-stranded DNA-binding protein Machinery gene
  ACMGFB_RS05210 (ACMGFB_05210) - 977407..977607 (-) 201 WP_414049811.1 hypothetical protein -
  ACMGFB_RS05215 (ACMGFB_05215) - 977604..977780 (-) 177 WP_414049812.1 hypothetical protein -
  ACMGFB_RS05220 (ACMGFB_05220) - 977752..977910 (-) 159 WP_414049813.1 hypothetical protein -
  ACMGFB_RS05225 (ACMGFB_05225) - 977921..978250 (-) 330 WP_414049814.1 hypothetical protein -
  ACMGFB_RS05230 (ACMGFB_05230) - 978251..978421 (-) 171 WP_414049815.1 hypothetical protein -
  ACMGFB_RS05235 (ACMGFB_05235) - 978414..979208 (-) 795 WP_414049816.1 ATP-binding protein -
  ACMGFB_RS05240 (ACMGFB_05240) - 979220..980020 (-) 801 WP_414049817.1 phage replisome organizer N-terminal domain-containing protein -
  ACMGFB_RS05245 (ACMGFB_05245) - 980035..980751 (-) 717 WP_414049818.1 MBL fold metallo-hydrolase -
  ACMGFB_RS05250 (ACMGFB_05250) bet 980748..981491 (-) 744 WP_414049819.1 phage recombination protein Bet -
  ACMGFB_RS05255 (ACMGFB_05255) - 981494..983470 (-) 1977 WP_414049820.1 AAA family ATPase -
  ACMGFB_RS05260 (ACMGFB_05260) - 983503..983667 (-) 165 WP_414049821.1 hypothetical protein -
  ACMGFB_RS05265 (ACMGFB_05265) - 983664..984017 (-) 354 WP_414049822.1 hypothetical protein -
  ACMGFB_RS05270 (ACMGFB_05270) - 984014..984805 (-) 792 WP_414049823.1 phage regulatory protein/antirepressor Ant -
  ACMGFB_RS05275 (ACMGFB_05275) - 984802..984957 (-) 156 WP_414049824.1 hypothetical protein -
  ACMGFB_RS05280 (ACMGFB_05280) - 984958..985134 (-) 177 WP_414049825.1 hypothetical protein -
  ACMGFB_RS05285 (ACMGFB_05285) - 985135..985386 (-) 252 WP_414049826.1 hypothetical protein -
  ACMGFB_RS05290 (ACMGFB_05290) - 985396..985899 (-) 504 WP_414049827.1 helix-turn-helix domain-containing protein -
  ACMGFB_RS05295 (ACMGFB_05295) - 986015..986293 (-) 279 WP_414049828.1 helix-turn-helix transcriptional regulator -
  ACMGFB_RS05300 (ACMGFB_05300) - 986433..986774 (+) 342 WP_414049829.1 helix-turn-helix domain-containing protein -
  ACMGFB_RS05305 (ACMGFB_05305) - 986949..988028 (+) 1080 WP_414049830.1 type I restriction endonuclease -
  ACMGFB_RS05310 (ACMGFB_05310) - 988043..989152 (+) 1110 WP_414049831.1 hypothetical protein -
  ACMGFB_RS05315 (ACMGFB_05315) - 989274..989735 (+) 462 WP_414049832.1 ImmA/IrrE family metallo-endopeptidase -
  ACMGFB_RS05320 (ACMGFB_05320) - 989739..990953 (+) 1215 WP_414049833.1 tyrosine-type recombinase/integrase -
  ACMGFB_RS05325 (ACMGFB_05325) - 991020..991145 (-) 126 WP_414049834.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  ACMGFB_RS05330 (ACMGFB_05330) comGB 991157..992194 (-) 1038 WP_414042933.1 competence type IV pilus assembly protein ComGB -

Sequence

Protein


Download         Length: 170 a.a.        Molecular weight: 18869.63 Da        Isoelectric Point: 6.3159

>NTDB_id=1092890 ACMGFB_RS05205 WP_414049810.1 976905..977417(-) (ssbA) [Macrococcus sp. 21M1142]
MINRVVLVGRLTKEPEYKVTPSGVSVATFTLAINRNFTNAQGERQADFINCIVFRKQAENVNNYLNKGSLAGVEGRLQSR
SYDNQEGRKVFVTEVICDSVQFLEPKNSQNQSNNAPQQTNYNQTNNNAQNQNNAQQGQNNANNGYGQQPQPNPFANATGP
IEIDDSTLPF

Nucleotide


Download         Length: 513 bp        

>NTDB_id=1092890 ACMGFB_RS05205 WP_414049810.1 976905..977417(-) (ssbA) [Macrococcus sp. 21M1142]
ATGATAAATAGAGTTGTACTTGTTGGACGTTTAACAAAAGAACCCGAATATAAAGTAACGCCATCTGGAGTATCTGTCGC
TACTTTCACGCTAGCAATTAATCGTAACTTTACGAACGCACAAGGAGAAAGACAAGCTGATTTTATTAATTGCATAGTGT
TCCGTAAACAAGCAGAGAACGTAAACAACTATCTAAATAAAGGTTCATTAGCAGGAGTTGAAGGTCGTCTCCAATCACGT
AGTTATGACAATCAAGAAGGACGAAAAGTATTCGTTACTGAAGTTATTTGTGACAGTGTGCAATTCCTAGAACCGAAGAA
TAGTCAAAATCAATCAAATAACGCACCACAACAAACGAATTACAATCAGACAAACAACAACGCTCAAAATCAAAACAATG
CACAACAAGGGCAAAATAACGCAAATAATGGATATGGTCAACAACCACAACCGAATCCATTTGCAAATGCAACTGGACCG
ATTGAAATTGATGATTCGACCTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.866

100

0.588
  ssb Latilactobacillus sakei subsp. sakei 23K

49.714

100

0.512
  ssb Glaesserella parasuis strain SC1401

35.135

100

0.382

Multiple sequence alignment