Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACK25W_RS14325 | Genome accession | NZ_CP179722 |
| Coordinates | 2786715..2786855 (-) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus pumilus strain FJAT-56819 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2781715..2791855
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACK25W_RS14300 (ACK25W_14300) | - | 2781981..2782370 (-) | 390 | WP_003213775.1 | hotdog fold thioesterase | - |
| ACK25W_RS14305 (ACK25W_14305) | comA | 2782394..2783035 (-) | 642 | WP_060597210.1 | response regulator transcription factor | Regulator |
| ACK25W_RS14310 (ACK25W_14310) | comP | 2783116..2785428 (-) | 2313 | WP_066030466.1 | ATP-binding protein | Regulator |
| ACK25W_RS14315 (ACK25W_14315) | comX | 2785485..2785652 (-) | 168 | WP_081311380.1 | competence pheromone ComX | - |
| ACK25W_RS14320 (ACK25W_14320) | - | 2785649..2786563 (-) | 915 | WP_081311379.1 | polyprenyl synthetase family protein | - |
| ACK25W_RS14325 (ACK25W_14325) | degQ | 2786715..2786855 (-) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACK25W_RS14330 (ACK25W_14330) | - | 2787361..2787714 (+) | 354 | WP_060597216.1 | hypothetical protein | - |
| ACK25W_RS14335 (ACK25W_14335) | - | 2787748..2788974 (-) | 1227 | WP_106072124.1 | EAL and HDOD domain-containing protein | - |
| ACK25W_RS14340 (ACK25W_14340) | - | 2789113..2790582 (-) | 1470 | WP_034659831.1 | nicotinate phosphoribosyltransferase | - |
| ACK25W_RS14345 (ACK25W_14345) | - | 2790600..2791151 (-) | 552 | WP_127687105.1 | cysteine hydrolase family protein | - |
| ACK25W_RS14350 (ACK25W_14350) | - | 2791212..2791619 (-) | 408 | WP_060597219.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=1092870 ACK25W_RS14325 WP_003213123.1 2786715..2786855(-) (degQ) [Bacillus pumilus strain FJAT-56819]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1092870 ACK25W_RS14325 WP_003213123.1 2786715..2786855(-) (degQ) [Bacillus pumilus strain FJAT-56819]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |