Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACK25W_RS14325 Genome accession   NZ_CP179722
Coordinates   2786715..2786855 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain FJAT-56819     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2781715..2791855
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK25W_RS14300 (ACK25W_14300) - 2781981..2782370 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  ACK25W_RS14305 (ACK25W_14305) comA 2782394..2783035 (-) 642 WP_060597210.1 response regulator transcription factor Regulator
  ACK25W_RS14310 (ACK25W_14310) comP 2783116..2785428 (-) 2313 WP_066030466.1 ATP-binding protein Regulator
  ACK25W_RS14315 (ACK25W_14315) comX 2785485..2785652 (-) 168 WP_081311380.1 competence pheromone ComX -
  ACK25W_RS14320 (ACK25W_14320) - 2785649..2786563 (-) 915 WP_081311379.1 polyprenyl synthetase family protein -
  ACK25W_RS14325 (ACK25W_14325) degQ 2786715..2786855 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACK25W_RS14330 (ACK25W_14330) - 2787361..2787714 (+) 354 WP_060597216.1 hypothetical protein -
  ACK25W_RS14335 (ACK25W_14335) - 2787748..2788974 (-) 1227 WP_106072124.1 EAL and HDOD domain-containing protein -
  ACK25W_RS14340 (ACK25W_14340) - 2789113..2790582 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  ACK25W_RS14345 (ACK25W_14345) - 2790600..2791151 (-) 552 WP_127687105.1 cysteine hydrolase family protein -
  ACK25W_RS14350 (ACK25W_14350) - 2791212..2791619 (-) 408 WP_060597219.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1092870 ACK25W_RS14325 WP_003213123.1 2786715..2786855(-) (degQ) [Bacillus pumilus strain FJAT-56819]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1092870 ACK25W_RS14325 WP_003213123.1 2786715..2786855(-) (degQ) [Bacillus pumilus strain FJAT-56819]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment