Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACL66B_RS12155 Genome accession   NZ_CP178617
Coordinates   2380474..2380647 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain QXKL-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2375474..2385647
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL66B_RS12140 (ACL66B_12140) gcvT 2376274..2377362 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  ACL66B_RS12145 (ACL66B_12145) hepAA 2377803..2379476 (+) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  ACL66B_RS12150 (ACL66B_12150) yqhG 2379497..2380291 (+) 795 WP_003230200.1 YqhG family protein -
  ACL66B_RS12155 (ACL66B_12155) sinI 2380474..2380647 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACL66B_RS12160 (ACL66B_12160) sinR 2380681..2381016 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACL66B_RS12165 (ACL66B_12165) tasA 2381109..2381894 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  ACL66B_RS12170 (ACL66B_12170) sipW 2381958..2382530 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACL66B_RS12175 (ACL66B_12175) tapA 2382514..2383275 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ACL66B_RS12180 (ACL66B_12180) yqzG 2383547..2383873 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACL66B_RS12185 (ACL66B_12185) spoIITA 2383915..2384094 (-) 180 WP_003230176.1 YqzE family protein -
  ACL66B_RS12190 (ACL66B_12190) comGG 2384165..2384539 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ACL66B_RS12195 (ACL66B_12195) comGF 2384540..2384923 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ACL66B_RS12200 (ACL66B_12200) comGE 2384949..2385296 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1090562 ACL66B_RS12155 WP_003230187.1 2380474..2380647(+) (sinI) [Bacillus subtilis strain QXKL-3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1090562 ACL66B_RS12155 WP_003230187.1 2380474..2380647(+) (sinI) [Bacillus subtilis strain QXKL-3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment