Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABFT42_RS15985 Genome accession   NZ_CP178596
Coordinates   3063727..3063867 (-) Length   46 a.a.
NCBI ID   WP_010331694.1    Uniprot ID   A0AAP3CUJ5
Organism   Bacillus mojavensis strain C3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3058727..3068867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFT42_RS15960 (ABFT42_15960) - 3059070..3059450 (-) 381 WP_106022011.1 hotdog fold thioesterase -
  ABFT42_RS15965 (ABFT42_15965) comA 3059468..3060112 (-) 645 WP_010331690.1 two-component system response regulator ComA Regulator
  ABFT42_RS15970 (ABFT42_15970) comP 3060193..3062493 (-) 2301 WP_268471514.1 histidine kinase Regulator
  ABFT42_RS15975 (ABFT42_15975) comX 3062505..3062669 (-) 165 WP_268471515.1 competence pheromone ComX -
  ABFT42_RS15980 (ABFT42_15980) - 3062682..3063542 (-) 861 WP_268471516.1 polyprenyl synthetase family protein -
  ABFT42_RS15985 (ABFT42_15985) degQ 3063727..3063867 (-) 141 WP_010331694.1 degradation enzyme regulation protein DegQ Regulator
  ABFT42_RS15990 (ABFT42_15990) - 3064328..3064696 (+) 369 WP_010331695.1 hypothetical protein -
  ABFT42_RS15995 (ABFT42_15995) - 3064672..3065901 (-) 1230 WP_010331696.1 EAL and HDOD domain-containing protein -
  ABFT42_RS16000 (ABFT42_16000) - 3066037..3067506 (-) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  ABFT42_RS16005 (ABFT42_16005) - 3067522..3068073 (-) 552 WP_413286516.1 cysteine hydrolase family protein -
  ABFT42_RS16010 (ABFT42_16010) - 3068170..3068568 (-) 399 WP_168748645.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5517.44 Da        Isoelectric Point: 6.2565

>NTDB_id=1090338 ABFT42_RS15985 WP_010331694.1 3063727..3063867(-) (degQ) [Bacillus mojavensis strain C3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090338 ABFT42_RS15985 WP_010331694.1 3063727..3063867(-) (degQ) [Bacillus mojavensis strain C3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957

Multiple sequence alignment