Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJGE3_RS09620 Genome accession   NZ_CP178562
Coordinates   2000658..2000798 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JT-3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1995658..2005798
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE3_RS09595 (ACJGE3_09595) - 1996022..1996405 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACJGE3_RS09600 (ACJGE3_09600) comA 1996427..1997071 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACJGE3_RS09605 (ACJGE3_09605) comP 1997152..1999434 (-) 2283 WP_413353722.1 histidine kinase Regulator
  ACJGE3_RS09610 (ACJGE3_09610) comX 1999448..1999621 (-) 174 WP_102422026.1 competence pheromone ComX -
  ACJGE3_RS09615 (ACJGE3_09615) - 1999590..2000450 (-) 861 WP_180997900.1 polyprenyl synthetase family protein -
  ACJGE3_RS09620 (ACJGE3_09620) degQ 2000658..2000798 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACJGE3_RS09625 (ACJGE3_09625) - 2001263..2001604 (+) 342 WP_014305721.1 hypothetical protein -
  ACJGE3_RS09630 (ACJGE3_09630) - 2001611..2002831 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACJGE3_RS09635 (ACJGE3_09635) - 2002961..2004427 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACJGE3_RS09640 (ACJGE3_09640) - 2004445..2004996 (-) 552 WP_146275407.1 cysteine hydrolase family protein -
  ACJGE3_RS09645 (ACJGE3_09645) - 2005093..2005491 (-) 399 WP_369614389.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1090176 ACJGE3_RS09620 WP_003152043.1 2000658..2000798(-) (degQ) [Bacillus velezensis strain JT-3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090176 ACJGE3_RS09620 WP_003152043.1 2000658..2000798(-) (degQ) [Bacillus velezensis strain JT-3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment