Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLZ2J_RS17040 Genome accession   NZ_CP178514
Coordinates   3224657..3224797 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BS18-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3219657..3229797
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLZ2J_RS17015 yuxO 3219969..3220349 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACLZ2J_RS17020 comA 3220368..3221012 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLZ2J_RS17025 comP 3221093..3223403 (-) 2311 Protein_3289 two-component system sensor histidine kinase ComP -
  ACLZ2J_RS17030 comX 3223418..3223585 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACLZ2J_RS17035 comQ 3223573..3224472 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACLZ2J_RS17040 degQ 3224657..3224797 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLZ2J_RS17045 - 3225019..3225144 (+) 126 WP_003228793.1 hypothetical protein -
  ACLZ2J_RS17050 - 3225258..3225626 (+) 369 WP_003243784.1 hypothetical protein -
  ACLZ2J_RS17055 pdeH 3225602..3226831 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACLZ2J_RS17060 pncB 3226968..3228440 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACLZ2J_RS17065 pncA 3228456..3229007 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  ACLZ2J_RS17070 yueI 3229104..3229502 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1089832 ACLZ2J_RS17040 WP_003220708.1 3224657..3224797(-) (degQ) [Bacillus subtilis strain BS18-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1089832 ACLZ2J_RS17040 WP_003220708.1 3224657..3224797(-) (degQ) [Bacillus subtilis strain BS18-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment