Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ACLZ2J_RS17030 Genome accession   NZ_CP178514
Coordinates   3223418..3223585 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain BS18-1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3218418..3228585
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLZ2J_RS17000 mrpE 3218812..3219288 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  ACLZ2J_RS17005 mrpF 3219288..3219572 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ACLZ2J_RS17010 mnhG 3219556..3219930 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  ACLZ2J_RS17015 yuxO 3219969..3220349 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACLZ2J_RS17020 comA 3220368..3221012 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACLZ2J_RS17025 comP 3221093..3223403 (-) 2311 Protein_3289 two-component system sensor histidine kinase ComP -
  ACLZ2J_RS17030 comX 3223418..3223585 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACLZ2J_RS17035 comQ 3223573..3224472 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACLZ2J_RS17040 degQ 3224657..3224797 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACLZ2J_RS17045 - 3225019..3225144 (+) 126 WP_003228793.1 hypothetical protein -
  ACLZ2J_RS17050 - 3225258..3225626 (+) 369 WP_003243784.1 hypothetical protein -
  ACLZ2J_RS17055 pdeH 3225602..3226831 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACLZ2J_RS17060 pncB 3226968..3228440 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1089830 ACLZ2J_RS17030 WP_003242801.1 3223418..3223585(-) (comX) [Bacillus subtilis strain BS18-1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1089830 ACLZ2J_RS17030 WP_003242801.1 3223418..3223585(-) (comX) [Bacillus subtilis strain BS18-1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment