Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACLJJ6_RS10140 Genome accession   NZ_CP178375
Coordinates   2119930..2120469 (+) Length   179 a.a.
NCBI ID   WP_412989325.1    Uniprot ID   -
Organism   Pediococcus siamensis strain LMG 24279     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2092648..2126805 2119930..2120469 within 0


Gene organization within MGE regions


Location: 2092648..2126805
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLJJ6_RS10025 (ACLJJ6_10025) - 2093289..2093801 (-) 513 WP_412989307.1 hypothetical protein -
  ACLJJ6_RS10030 (ACLJJ6_10030) - 2093978..2096296 (-) 2319 WP_412989308.1 SEC10/PgrA surface exclusion domain-containing protein -
  ACLJJ6_RS10035 (ACLJJ6_10035) - 2096453..2097334 (-) 882 WP_412989309.1 GW dipeptide domain-containing protein -
  ACLJJ6_RS10040 (ACLJJ6_10040) - 2097580..2097936 (+) 357 WP_412989310.1 hypothetical protein -
  ACLJJ6_RS10045 (ACLJJ6_10045) istB 2097940..2098770 (-) 831 WP_412988384.1 IS21-like element helper ATPase IstB -
  ACLJJ6_RS10050 (ACLJJ6_10050) istA 2098757..2099971 (-) 1215 WP_260210390.1 IS21 family transposase -
  ACLJJ6_RS10055 (ACLJJ6_10055) - 2100091..2101029 (+) 939 Protein_1934 ISL3 family transposase -
  ACLJJ6_RS10060 (ACLJJ6_10060) - 2101010..2102059 (-) 1050 WP_412989311.1 helix-turn-helix transcriptional regulator -
  ACLJJ6_RS10065 (ACLJJ6_10065) - 2102174..2102506 (-) 333 WP_412989312.1 hypothetical protein -
  ACLJJ6_RS10070 (ACLJJ6_10070) mnmG 2102539..2104446 (-) 1908 WP_412989313.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  ACLJJ6_RS10075 (ACLJJ6_10075) mnmE 2104518..2105909 (-) 1392 WP_412989314.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  ACLJJ6_RS10080 (ACLJJ6_10080) jag 2106070..2106888 (-) 819 WP_412989315.1 RNA-binding cell elongation regulator Jag/EloR -
  ACLJJ6_RS10085 (ACLJJ6_10085) yidC 2106976..2107812 (-) 837 WP_412989316.1 membrane protein insertase YidC -
  ACLJJ6_RS10090 (ACLJJ6_10090) rnpA 2107813..2108172 (-) 360 WP_412989317.1 ribonuclease P protein component -
  ACLJJ6_RS10095 (ACLJJ6_10095) rpmH 2108273..2108407 (-) 135 WP_412989318.1 50S ribosomal protein L34 -
  ACLJJ6_RS10100 (ACLJJ6_10100) dnaA 2108951..2110297 (+) 1347 WP_412989319.1 chromosomal replication initiator protein DnaA -
  ACLJJ6_RS10105 (ACLJJ6_10105) dnaN 2110473..2111612 (+) 1140 WP_412989320.1 DNA polymerase III subunit beta -
  ACLJJ6_RS10110 (ACLJJ6_10110) - 2111781..2113022 (-) 1242 WP_412988180.1 ISL3 family transposase -
  ACLJJ6_RS10115 (ACLJJ6_10115) yaaA 2113522..2113749 (+) 228 WP_412989321.1 S4 domain-containing protein YaaA -
  ACLJJ6_RS10120 (ACLJJ6_10120) recF 2113752..2114870 (+) 1119 WP_412989322.1 DNA replication/repair protein RecF -
  ACLJJ6_RS10125 (ACLJJ6_10125) gyrB 2114873..2116852 (+) 1980 WP_412989323.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  ACLJJ6_RS10130 (ACLJJ6_10130) gyrA 2116933..2119416 (+) 2484 WP_412990470.1 DNA gyrase subunit A -
  ACLJJ6_RS10135 (ACLJJ6_10135) rpsF 2119600..2119890 (+) 291 WP_412989324.1 30S ribosomal protein S6 -
  ACLJJ6_RS10140 (ACLJJ6_10140) ssb 2119930..2120469 (+) 540 WP_412989325.1 single-stranded DNA-binding protein Machinery gene
  ACLJJ6_RS10145 (ACLJJ6_10145) rpsR 2120492..2120731 (+) 240 WP_057750011.1 30S ribosomal protein S18 -
  ACLJJ6_RS10150 (ACLJJ6_10150) - 2120817..2122058 (-) 1242 WP_412988599.1 ISL3 family transposase -
  ACLJJ6_RS10155 (ACLJJ6_10155) - 2122430..2123110 (+) 681 WP_412989326.1 EAL domain-containing protein -
  ACLJJ6_RS10160 (ACLJJ6_10160) - 2123129..2124490 (+) 1362 WP_412989327.1 FAD-dependent oxidoreductase -
  ACLJJ6_RS10165 (ACLJJ6_10165) - 2124622..2125863 (-) 1242 WP_412988180.1 ISL3 family transposase -
  ACLJJ6_RS10170 (ACLJJ6_10170) - 2126116..2126805 (+) 690 WP_412989328.1 N-acetylmannosamine-6-phosphate 2-epimerase -

Sequence

Protein


Download         Length: 179 a.a.        Molecular weight: 19533.90 Da        Isoelectric Point: 4.4851

>NTDB_id=1089217 ACLJJ6_RS10140 WP_412989325.1 2119930..2120469(+) (ssb) [Pediococcus siamensis strain LMG 24279]
MINRTVLVGRLTRDPDLRYTNSGAAVATFTVAVNRQFTNSQGEREADFINCVIWRKAAENFSNFTHKGSLVGVDGRIQTR
SYENQQGQRVYVTEVVVENFSLLESRSQSEQRQQQSGNAGFQNNAPQSSGNTNPFDAGQGNNSSSNQSAGSSSSANSNPN
DPFADNGEQIDISDDDLPF

Nucleotide


Download         Length: 540 bp        

>NTDB_id=1089217 ACLJJ6_RS10140 WP_412989325.1 2119930..2120469(+) (ssb) [Pediococcus siamensis strain LMG 24279]
ATGATAAACCGAACAGTTCTTGTTGGACGCTTAACCAGAGATCCTGATTTACGATACACCAACAGTGGTGCTGCAGTGGC
AACTTTTACCGTCGCCGTTAACCGTCAGTTTACAAACTCGCAAGGGGAACGTGAAGCTGATTTTATTAATTGCGTGATTT
GGCGGAAAGCTGCGGAAAACTTCTCAAACTTTACCCATAAAGGCTCGTTGGTTGGTGTTGATGGACGAATTCAAACGCGT
TCTTACGAAAACCAGCAGGGTCAACGGGTTTATGTGACAGAAGTTGTTGTTGAAAACTTCTCGTTATTGGAATCTCGTTC
TCAATCTGAGCAGCGTCAACAGCAAAGTGGGAATGCAGGCTTTCAAAACAATGCTCCTCAATCATCCGGAAATACCAATC
CATTTGATGCCGGGCAAGGAAACAACAGTAGCAGCAACCAGAGTGCTGGAAGCTCGTCTAGTGCCAACTCTAACCCGAAT
GATCCATTCGCCGATAACGGTGAACAAATTGATATTTCCGACGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

67.582

100

0.687
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.564

100

0.592

Multiple sequence alignment