Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACLNGX_RS11980 Genome accession   NZ_CP178374
Coordinates   2536456..2536770 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain 2023     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2531456..2541770
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLNGX_RS11935 (ACLNGX_11935) sinI 2532139..2532312 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACLNGX_RS11940 (ACLNGX_11940) sinR 2532346..2532681 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACLNGX_RS11945 (ACLNGX_11945) tasA 2532729..2533514 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACLNGX_RS11950 (ACLNGX_11950) sipW 2533578..2534162 (-) 585 WP_060562614.1 signal peptidase I SipW -
  ACLNGX_RS11955 (ACLNGX_11955) tapA 2534134..2534805 (-) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  ACLNGX_RS11960 (ACLNGX_11960) - 2535064..2535393 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  ACLNGX_RS11965 (ACLNGX_11965) - 2535433..2535612 (-) 180 WP_003153093.1 YqzE family protein -
  ACLNGX_RS11970 (ACLNGX_11970) comGG 2535669..2536046 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACLNGX_RS11975 (ACLNGX_11975) comGF 2536047..2536442 (-) 396 WP_071391610.1 competence type IV pilus minor pilin ComGF -
  ACLNGX_RS11980 (ACLNGX_11980) comGE 2536456..2536770 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACLNGX_RS11985 (ACLNGX_11985) comGD 2536754..2537191 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACLNGX_RS11990 (ACLNGX_11990) comGC 2537181..2537489 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACLNGX_RS11995 (ACLNGX_11995) comGB 2537494..2538531 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACLNGX_RS12000 (ACLNGX_12000) comGA 2538518..2539588 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACLNGX_RS12005 (ACLNGX_12005) - 2539780..2540730 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1089157 ACLNGX_RS11980 WP_015388003.1 2536456..2536770(-) (comGE) [Bacillus velezensis strain 2023]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1089157 ACLNGX_RS11980 WP_015388003.1 2536456..2536770(-) (comGE) [Bacillus velezensis strain 2023]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment