Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACLNGX_RS11935 | Genome accession | NZ_CP178374 |
| Coordinates | 2532139..2532312 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 2023 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2527139..2537312
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLNGX_RS11920 (ACLNGX_11920) | gcvT | 2527956..2529056 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACLNGX_RS11925 (ACLNGX_11925) | - | 2529480..2531150 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| ACLNGX_RS11930 (ACLNGX_11930) | - | 2531168..2531962 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| ACLNGX_RS11935 (ACLNGX_11935) | sinI | 2532139..2532312 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACLNGX_RS11940 (ACLNGX_11940) | sinR | 2532346..2532681 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACLNGX_RS11945 (ACLNGX_11945) | tasA | 2532729..2533514 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACLNGX_RS11950 (ACLNGX_11950) | sipW | 2533578..2534162 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| ACLNGX_RS11955 (ACLNGX_11955) | tapA | 2534134..2534805 (-) | 672 | WP_071391613.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACLNGX_RS11960 (ACLNGX_11960) | - | 2535064..2535393 (+) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| ACLNGX_RS11965 (ACLNGX_11965) | - | 2535433..2535612 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACLNGX_RS11970 (ACLNGX_11970) | comGG | 2535669..2536046 (-) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACLNGX_RS11975 (ACLNGX_11975) | comGF | 2536047..2536442 (-) | 396 | WP_071391610.1 | competence type IV pilus minor pilin ComGF | - |
| ACLNGX_RS11980 (ACLNGX_11980) | comGE | 2536456..2536770 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACLNGX_RS11985 (ACLNGX_11985) | comGD | 2536754..2537191 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1089154 ACLNGX_RS11935 WP_003153105.1 2532139..2532312(+) (sinI) [Bacillus velezensis strain 2023]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1089154 ACLNGX_RS11935 WP_003153105.1 2532139..2532312(+) (sinI) [Bacillus velezensis strain 2023]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |