Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ACFCT9_RS12510 Genome accession   NZ_CP178241
Coordinates   2573383..2573862 (+) Length   159 a.a.
NCBI ID   WP_412519726.1    Uniprot ID   -
Organism   Staphylococcus simulans strain PFJB-50N     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2559287..2600710 2573383..2573862 within 0


Gene organization within MGE regions


Location: 2559287..2600710
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFCT9_RS12380 sufB 2559287..2560684 (+) 1398 WP_412519694.1 Fe-S cluster assembly protein SufB -
  ACFCT9_RS12385 - 2560752..2561801 (-) 1050 WP_412519696.1 tyrosine-type recombinase/integrase -
  ACFCT9_RS12390 - 2561936..2562532 (+) 597 WP_412519698.1 hypothetical protein -
  ACFCT9_RS12395 - 2562533..2562727 (-) 195 WP_412519699.1 hypothetical protein -
  ACFCT9_RS12400 - 2562714..2562932 (-) 219 WP_412519701.1 hypothetical protein -
  ACFCT9_RS12405 - 2562978..2563148 (-) 171 WP_412519702.1 hypothetical protein -
  ACFCT9_RS12410 - 2563221..2563892 (-) 672 WP_070864627.1 ImmA/IrrE family metallo-endopeptidase -
  ACFCT9_RS12415 - 2563905..2564243 (-) 339 WP_262583320.1 helix-turn-helix domain-containing protein -
  ACFCT9_RS12420 - 2564507..2564701 (+) 195 WP_053018059.1 helix-turn-helix domain-containing protein -
  ACFCT9_RS12425 - 2564701..2565483 (+) 783 WP_070864625.1 antA/AntB antirepressor family protein -
  ACFCT9_RS12430 - 2565522..2565722 (+) 201 WP_070864624.1 hypothetical protein -
  ACFCT9_RS12435 - 2565706..2565960 (-) 255 WP_412519705.1 hypothetical protein -
  ACFCT9_RS12440 - 2566020..2566793 (+) 774 Protein_2405 Rha family transcriptional regulator -
  ACFCT9_RS12445 - 2566805..2567020 (+) 216 WP_412519707.1 pathogenicity island protein -
  ACFCT9_RS12450 - 2567065..2567310 (+) 246 WP_412519709.1 MW1434 family type I TA system toxin -
  ACFCT9_RS12455 - 2567279..2567644 (-) 366 WP_070684229.1 hypothetical protein -
  ACFCT9_RS12460 - 2567727..2567987 (+) 261 WP_412519711.1 hypothetical protein -
  ACFCT9_RS12465 - 2568251..2568388 (+) 138 WP_412519713.1 hypothetical protein -
  ACFCT9_RS12470 - 2568410..2568637 (-) 228 WP_023015315.1 hypothetical protein -
  ACFCT9_RS12475 - 2568692..2568910 (+) 219 WP_105988757.1 hypothetical protein -
  ACFCT9_RS12480 - 2568926..2569141 (+) 216 WP_106421056.1 hypothetical protein -
  ACFCT9_RS12485 - 2569238..2569504 (+) 267 WP_412519716.1 DUF1108 family protein -
  ACFCT9_RS12490 - 2569507..2571459 (+) 1953 WP_412519718.1 AAA family ATPase -
  ACFCT9_RS12495 - 2571456..2571785 (+) 330 WP_412519720.1 hypothetical protein -
  ACFCT9_RS12500 - 2571782..2572684 (+) 903 WP_412519722.1 recombinase RecT -
  ACFCT9_RS12505 - 2572753..2573382 (+) 630 WP_412519724.1 MBL fold metallo-hydrolase -
  ACFCT9_RS12510 ssbA 2573383..2573862 (+) 480 WP_412519726.1 single-stranded DNA-binding protein Machinery gene
  ACFCT9_RS12515 - 2573893..2574813 (+) 921 WP_412519728.1 DnaD domain-containing protein -
  ACFCT9_RS12520 - 2574825..2575061 (+) 237 WP_412519730.1 hypothetical protein -
  ACFCT9_RS12525 - 2575042..2575242 (+) 201 WP_412519732.1 hypothetical protein -
  ACFCT9_RS12530 - 2575246..2575443 (+) 198 WP_412519734.1 DUF3269 family protein -
  ACFCT9_RS12535 - 2575627..2576016 (+) 390 WP_412519736.1 YopX family protein -
  ACFCT9_RS12540 - 2576021..2576623 (+) 603 WP_412519738.1 dUTP diphosphatase -
  ACFCT9_RS12545 - 2576667..2576843 (+) 177 WP_412519740.1 hypothetical protein -
  ACFCT9_RS12550 rinB 2576847..2576996 (+) 150 WP_412519742.1 transcriptional activator RinB -
  ACFCT9_RS12555 - 2576997..2577305 (+) 309 WP_412519743.1 hypothetical protein -
  ACFCT9_RS12560 - 2577448..2577867 (+) 420 WP_107539616.1 hypothetical protein -
  ACFCT9_RS12565 - 2578177..2578500 (+) 324 WP_412519744.1 HNH endonuclease -
  ACFCT9_RS12570 - 2578696..2579055 (+) 360 WP_412519746.1 hypothetical protein -
  ACFCT9_RS12575 - 2579052..2580713 (+) 1662 WP_412519748.1 terminase TerL endonuclease subunit -
  ACFCT9_RS12580 - 2580728..2581900 (+) 1173 WP_412519750.1 phage portal protein -
  ACFCT9_RS12585 - 2581875..2582696 (+) 822 WP_412519752.1 head maturation protease, ClpP-related -
  ACFCT9_RS12590 - 2582759..2583946 (+) 1188 WP_412519754.1 phage major capsid protein -
  ACFCT9_RS12595 - 2583964..2584260 (+) 297 WP_412519755.1 phage head-tail adapter protein -
  ACFCT9_RS12600 - 2584244..2584606 (+) 363 WP_412519757.1 phage head-tail adapter protein -
  ACFCT9_RS12605 - 2584603..2585004 (+) 402 WP_412519759.1 hypothetical protein -
  ACFCT9_RS12610 - 2585001..2585408 (+) 408 WP_412519760.1 hypothetical protein -
  ACFCT9_RS12615 - 2585422..2586003 (+) 582 Protein_2440 major tail protein -
  ACFCT9_RS12620 - 2585983..2586285 (+) 303 WP_412521689.1 Ig-like domain-containing protein -
  ACFCT9_RS12625 - 2586358..2586522 (+) 165 WP_412519762.1 hypothetical protein -
  ACFCT9_RS12630 gpG 2586537..2586896 (+) 360 WP_412519764.1 phage tail assembly chaperone G -
  ACFCT9_RS12635 gpGT 2586932..2587099 (+) 168 WP_412519766.1 phage tail assembly chaperone GT -
  ACFCT9_RS12640 - 2587159..2593314 (+) 6156 WP_412519767.1 phage tail tape measure protein -
  ACFCT9_RS12645 - 2593334..2594812 (+) 1479 WP_412519769.1 phage distal tail protein -
  ACFCT9_RS12650 - 2594828..2599825 (+) 4998 WP_412519771.1 phage tail spike protein -
  ACFCT9_RS12655 - 2599818..2600189 (+) 372 WP_412519772.1 hypothetical protein -
  ACFCT9_RS12660 - 2600207..2600359 (+) 153 WP_142922295.1 DNA replication initiation control protein YabA -
  ACFCT9_RS12665 - 2600423..2600710 (+) 288 WP_412519774.1 hypothetical protein -

Sequence

Protein


Download         Length: 159 a.a.        Molecular weight: 17999.76 Da        Isoelectric Point: 4.9528

>NTDB_id=1088634 ACFCT9_RS12510 WP_412519726.1 2573383..2573862(+) (ssbA) [Staphylococcus simulans strain PFJB-50N]
MINRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTYTNAQGEREADFINCVVFRKQAENVSNYLFKGSLAGVDGRLQSR
SYENDEGRKIFVTEVLVDSVQFLEPKKSQKTQQDSYYNANNTKQQYGQNNTNQKQSVNDNNPFANSNDPVDIQDDDLPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=1088634 ACFCT9_RS12510 WP_412519726.1 2573383..2573862(+) (ssbA) [Staphylococcus simulans strain PFJB-50N]
ATGATTAATAGAGTCGTATTAGTAGGCCGTTTAACTAAGGATCCTGAATACAGAACGACACCCTCAGGCGTAAGTGTAGC
GACTTTTACTCTAGCGGTTAATCGTACGTATACGAATGCGCAAGGGGAACGTGAAGCAGACTTTATTAACTGTGTTGTTT
TTAGAAAACAAGCAGAAAACGTAAGCAATTACTTGTTTAAAGGAAGTCTTGCAGGCGTTGATGGTCGCTTACAATCACGT
AGTTATGAGAATGACGAAGGAAGAAAAATATTTGTTACAGAAGTATTAGTGGACAGTGTTCAATTTTTAGAACCTAAAAA
AAGCCAAAAAACACAACAAGACAGCTACTACAATGCAAACAACACTAAACAGCAATATGGCCAAAATAATACAAATCAGA
AGCAATCAGTTAATGATAATAATCCATTTGCAAATTCTAATGATCCAGTCGATATCCAAGATGACGATCTTCCCTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

60.116

100

0.654
  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.553
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.091

69.182

0.409

Multiple sequence alignment