Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACLD94_RS11370 Genome accession   NZ_CP178220
Coordinates   2381182..2381559 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain JN-Y2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2376182..2386559
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLD94_RS11330 (ACLD94_11330) - 2376679..2377473 (+) 795 WP_007612541.1 YqhG family protein -
  ACLD94_RS11335 (ACLD94_11335) sinI 2377650..2377823 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ACLD94_RS11340 (ACLD94_11340) sinR 2377857..2378192 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACLD94_RS11345 (ACLD94_11345) tasA 2378240..2379025 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACLD94_RS11350 (ACLD94_11350) sipW 2379090..2379674 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACLD94_RS11355 (ACLD94_11355) tapA 2379646..2380317 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACLD94_RS11360 (ACLD94_11360) - 2380576..2380905 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACLD94_RS11365 (ACLD94_11365) - 2380946..2381125 (-) 180 WP_022552966.1 YqzE family protein -
  ACLD94_RS11370 (ACLD94_11370) comGG 2381182..2381559 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACLD94_RS11375 (ACLD94_11375) comGF 2381560..2382060 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACLD94_RS11380 (ACLD94_11380) comGE 2381969..2382283 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACLD94_RS11385 (ACLD94_11385) comGD 2382267..2382704 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACLD94_RS11390 (ACLD94_11390) comGC 2382694..2383002 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACLD94_RS11395 (ACLD94_11395) comGB 2383007..2384044 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACLD94_RS11400 (ACLD94_11400) comGA 2384031..2385101 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACLD94_RS11405 (ACLD94_11405) - 2385298..2386248 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=1088465 ACLD94_RS11370 WP_032874019.1 2381182..2381559(-) (comGG) [Bacillus velezensis strain JN-Y2]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1088465 ACLD94_RS11370 WP_032874019.1 2381182..2381559(-) (comGG) [Bacillus velezensis strain JN-Y2]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488


Multiple sequence alignment