Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACLD94_RS11335 | Genome accession | NZ_CP178220 |
| Coordinates | 2377650..2377823 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain JN-Y2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2372650..2382823
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLD94_RS11320 (ACLD94_11320) | gcvT | 2373464..2374564 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACLD94_RS11325 (ACLD94_11325) | - | 2374987..2376657 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| ACLD94_RS11330 (ACLD94_11330) | - | 2376679..2377473 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| ACLD94_RS11335 (ACLD94_11335) | sinI | 2377650..2377823 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| ACLD94_RS11340 (ACLD94_11340) | sinR | 2377857..2378192 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACLD94_RS11345 (ACLD94_11345) | tasA | 2378240..2379025 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| ACLD94_RS11350 (ACLD94_11350) | sipW | 2379090..2379674 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| ACLD94_RS11355 (ACLD94_11355) | tapA | 2379646..2380317 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACLD94_RS11360 (ACLD94_11360) | - | 2380576..2380905 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| ACLD94_RS11365 (ACLD94_11365) | - | 2380946..2381125 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| ACLD94_RS11370 (ACLD94_11370) | comGG | 2381182..2381559 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACLD94_RS11375 (ACLD94_11375) | comGF | 2381560..2382060 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| ACLD94_RS11380 (ACLD94_11380) | comGE | 2381969..2382283 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACLD94_RS11385 (ACLD94_11385) | comGD | 2382267..2382704 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=1088463 ACLD94_RS11335 WP_032874029.1 2377650..2377823(+) (sinI) [Bacillus velezensis strain JN-Y2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1088463 ACLD94_RS11335 WP_032874029.1 2377650..2377823(+) (sinI) [Bacillus velezensis strain JN-Y2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |