Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACLII2_RS08795 Genome accession   NZ_CP178213
Coordinates   1660915..1661289 (+) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis strain BM107     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1655915..1666289
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLII2_RS08760 corA 1655984..1656937 (+) 954 WP_004399136.1 magnesium transporter CorA -
  ACLII2_RS08765 comGA 1657349..1658419 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ACLII2_RS08770 comGB 1658406..1659443 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ACLII2_RS08775 comGC 1659457..1659753 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACLII2_RS08780 comGD 1659743..1660174 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ACLII2_RS08785 comGE 1660158..1660505 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ACLII2_RS08790 comGF 1660531..1660914 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACLII2_RS08795 comGG 1660915..1661289 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACLII2_RS08800 spoIITA 1661360..1661539 (+) 180 WP_003230176.1 YqzE family protein -
  ACLII2_RS08805 yqzG 1661581..1661907 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLII2_RS08810 tapA 1662179..1662940 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACLII2_RS08815 sipW 1662924..1663496 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ACLII2_RS08820 tasA 1663560..1664345 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACLII2_RS08825 sinR 1664438..1664773 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLII2_RS08830 sinI 1664807..1664980 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLII2_RS08835 yqhG 1665163..1665957 (-) 795 WP_003230200.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=1088301 ACLII2_RS08795 WP_003230170.1 1660915..1661289(+) (comGG) [Bacillus subtilis subsp. subtilis strain BM107]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1088301 ACLII2_RS08795 WP_003230170.1 1660915..1661289(+) (comGG) [Bacillus subtilis subsp. subtilis strain BM107]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment