Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACLII2_RS08830 Genome accession   NZ_CP178213
Coordinates   1664807..1664980 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain BM107     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1659807..1669980
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLII2_RS08785 comGE 1660158..1660505 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ACLII2_RS08790 comGF 1660531..1660914 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ACLII2_RS08795 comGG 1660915..1661289 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ACLII2_RS08800 spoIITA 1661360..1661539 (+) 180 WP_003230176.1 YqzE family protein -
  ACLII2_RS08805 yqzG 1661581..1661907 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACLII2_RS08810 tapA 1662179..1662940 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACLII2_RS08815 sipW 1662924..1663496 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ACLII2_RS08820 tasA 1663560..1664345 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACLII2_RS08825 sinR 1664438..1664773 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACLII2_RS08830 sinI 1664807..1664980 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACLII2_RS08835 yqhG 1665163..1665957 (-) 795 WP_003230200.1 YqhG family protein -
  ACLII2_RS08840 hepAA 1665978..1667651 (-) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ACLII2_RS08845 gcvT 1668093..1669181 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1088303 ACLII2_RS08830 WP_003230187.1 1664807..1664980(-) (sinI) [Bacillus subtilis subsp. subtilis strain BM107]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1088303 ACLII2_RS08830 WP_003230187.1 1664807..1664980(-) (sinI) [Bacillus subtilis subsp. subtilis strain BM107]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment