Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACLII2_RS08830 | Genome accession | NZ_CP178213 |
| Coordinates | 1664807..1664980 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain BM107 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1659807..1669980
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLII2_RS08785 | comGE | 1660158..1660505 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| ACLII2_RS08790 | comGF | 1660531..1660914 (+) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| ACLII2_RS08795 | comGG | 1660915..1661289 (+) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| ACLII2_RS08800 | spoIITA | 1661360..1661539 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| ACLII2_RS08805 | yqzG | 1661581..1661907 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| ACLII2_RS08810 | tapA | 1662179..1662940 (+) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACLII2_RS08815 | sipW | 1662924..1663496 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| ACLII2_RS08820 | tasA | 1663560..1664345 (+) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| ACLII2_RS08825 | sinR | 1664438..1664773 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ACLII2_RS08830 | sinI | 1664807..1664980 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| ACLII2_RS08835 | yqhG | 1665163..1665957 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| ACLII2_RS08840 | hepAA | 1665978..1667651 (-) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| ACLII2_RS08845 | gcvT | 1668093..1669181 (+) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1088303 ACLII2_RS08830 WP_003230187.1 1664807..1664980(-) (sinI) [Bacillus subtilis subsp. subtilis strain BM107]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1088303 ACLII2_RS08830 WP_003230187.1 1664807..1664980(-) (sinI) [Bacillus subtilis subsp. subtilis strain BM107]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |