Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACK3B6_RS16385 Genome accession   NZ_CP176792
Coordinates   3192129..3192269 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain BCP32     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3187129..3197269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK3B6_RS16360 (ACK3B6_16360) - 3187472..3187852 (-) 381 WP_024122679.1 hotdog fold thioesterase -
  ACK3B6_RS16365 (ACK3B6_16365) comA 3187870..3188514 (-) 645 WP_101864137.1 two-component system response regulator ComA Regulator
  ACK3B6_RS16370 (ACK3B6_16370) comP 3188595..3190895 (-) 2301 WP_105991649.1 histidine kinase Regulator
  ACK3B6_RS16375 (ACK3B6_16375) comX 3190907..3191071 (-) 165 WP_105991648.1 competence pheromone ComX -
  ACK3B6_RS16380 (ACK3B6_16380) - 3191084..3191944 (-) 861 WP_105991687.1 polyprenyl synthetase family protein -
  ACK3B6_RS16385 (ACK3B6_16385) degQ 3192129..3192269 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  ACK3B6_RS16390 (ACK3B6_16390) - 3192730..3193098 (+) 369 WP_105955477.1 hypothetical protein -
  ACK3B6_RS16395 (ACK3B6_16395) - 3193074..3194303 (-) 1230 WP_059334756.1 EAL and HDOD domain-containing protein -
  ACK3B6_RS16400 (ACK3B6_16400) - 3194439..3195908 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  ACK3B6_RS16405 (ACK3B6_16405) - 3195924..3196475 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  ACK3B6_RS16410 (ACK3B6_16410) - 3196572..3196970 (-) 399 WP_416042835.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1083024 ACK3B6_RS16385 WP_024122683.1 3192129..3192269(-) (degQ) [Bacillus halotolerans strain BCP32]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1083024 ACK3B6_RS16385 WP_024122683.1 3192129..3192269(-) (degQ) [Bacillus halotolerans strain BCP32]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment