Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AACH71_RS17985 Genome accession   NZ_AP029050
Coordinates   3551029..3551169 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus stercoris strain BST19     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3546029..3556169
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AACH71_RS17955 (BSB_34590) - 3546324..3546722 (+) 399 WP_069840242.1 YueI family protein -
  AACH71_RS17960 (BSB_34600) - 3546819..3547370 (+) 552 WP_014665196.1 isochorismatase family cysteine hydrolase -
  AACH71_RS17965 (BSB_34610) - 3547386..3548858 (+) 1473 WP_014665195.1 nicotinate phosphoribosyltransferase -
  AACH71_RS17970 (BSB_34620) pdeH 3548994..3550223 (+) 1230 WP_014665194.1 cyclic di-GMP phosphodiesterase -
  AACH71_RS17975 (BSB_34630) - 3550199..3550567 (-) 369 WP_014665193.1 hypothetical protein -
  AACH71_RS17980 - 3550682..3550807 (-) 126 WP_128422565.1 hypothetical protein -
  AACH71_RS17985 (BSB_34640) degQ 3551029..3551169 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AACH71_RS17990 (BSB_34650) comQ 3551354..3552253 (+) 900 WP_103750156.1 ComX modifying isoprenyl transferase ComQ Regulator
  AACH71_RS17995 (BSB_34660) comX 3552241..3552408 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  AACH71_RS18000 comP 3552423..3554732 (+) 2310 Protein_3505 two-component system sensor histidine kinase ComP -
  AACH71_RS18005 (BSB_34700) comA 3554813..3555457 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AACH71_RS18010 (BSB_34710) - 3555475..3555855 (+) 381 WP_040081970.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=108294 AACH71_RS17985 WP_003220708.1 3551029..3551169(+) (degQ) [Bacillus stercoris strain BST19]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=108294 AACH71_RS17985 WP_003220708.1 3551029..3551169(+) (degQ) [Bacillus stercoris strain BST19]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATCGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment