Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AACH71_RS00575 Genome accession   NZ_AP029050
Coordinates   95883..96056 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus stercoris strain BST19     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 90883..101056
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AACH71_RS00530 (BSB_01040) comGE 91242..91589 (+) 348 WP_071581437.1 competence type IV pilus minor pilin ComGE Machinery gene
  AACH71_RS00535 (BSB_01050) comGF 91615..91995 (+) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  AACH71_RS00540 (BSB_01060) comGG 91996..92370 (+) 375 WP_069149864.1 competence type IV pilus minor pilin ComGG Machinery gene
  AACH71_RS00545 (BSB_01070) - 92442..92621 (+) 180 WP_014480252.1 YqzE family protein -
  AACH71_RS00550 (BSB_01080) - 92662..92988 (-) 327 WP_014664589.1 YqzG/YhdC family protein -
  AACH71_RS00555 (BSB_01090) tapA 93260..94015 (+) 756 WP_134975341.1 amyloid fiber anchoring/assembly protein TapA -
  AACH71_RS00560 (BSB_01100) - 93999..94571 (+) 573 WP_080478339.1 signal peptidase I -
  AACH71_RS00565 (BSB_01110) tasA 94635..95420 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  AACH71_RS00570 (BSB_01120) sinR 95514..95849 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AACH71_RS00575 (BSB_01130) sinI 95883..96056 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AACH71_RS00580 (BSB_01140) - 96240..97034 (-) 795 WP_069839479.1 YqhG family protein -
  AACH71_RS00585 (BSB_01150) - 97055..98728 (-) 1674 WP_136654210.1 SNF2-related protein -
  AACH71_RS00590 (BSB_01160) gcvT 99170..100258 (+) 1089 WP_069149859.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=108238 AACH71_RS00575 WP_003230187.1 95883..96056(-) (sinI) [Bacillus stercoris strain BST19]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=108238 AACH71_RS00575 WP_003230187.1 95883..96056(-) (sinI) [Bacillus stercoris strain BST19]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment