Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   AACH71_RS00535 Genome accession   NZ_AP029050
Coordinates   91615..91995 (+) Length   126 a.a.
NCBI ID   WP_014664591.1    Uniprot ID   -
Organism   Bacillus stercoris strain BST19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 86615..96995
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AACH71_RS00500 (BSB_00970) corA 86795..87748 (+) 954 WP_103030653.1 magnesium transporter CorA -
  AACH71_RS00505 (BSB_00980) - 87811..88221 (+) 411 WP_136654214.1 CBS domain-containing protein -
  AACH71_RS00510 (BSB_01000) comGA 88433..89503 (+) 1071 WP_095431688.1 competence protein ComGA Machinery gene
  AACH71_RS00515 (BSB_01010) comGB 89490..90527 (+) 1038 WP_136654212.1 competence type IV pilus assembly protein ComGB Machinery gene
  AACH71_RS00520 (BSB_01020) comGC 90541..90837 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AACH71_RS00525 (BSB_01030) comGD 90827..91258 (+) 432 WP_136654211.1 competence type IV pilus minor pilin ComGD Machinery gene
  AACH71_RS00530 (BSB_01040) comGE 91242..91589 (+) 348 WP_071581437.1 competence type IV pilus minor pilin ComGE Machinery gene
  AACH71_RS00535 (BSB_01050) comGF 91615..91995 (+) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  AACH71_RS00540 (BSB_01060) comGG 91996..92370 (+) 375 WP_069149864.1 competence type IV pilus minor pilin ComGG Machinery gene
  AACH71_RS00545 (BSB_01070) - 92442..92621 (+) 180 WP_014480252.1 YqzE family protein -
  AACH71_RS00550 (BSB_01080) - 92662..92988 (-) 327 WP_014664589.1 YqzG/YhdC family protein -
  AACH71_RS00555 (BSB_01090) tapA 93260..94015 (+) 756 WP_134975341.1 amyloid fiber anchoring/assembly protein TapA -
  AACH71_RS00560 (BSB_01100) - 93999..94571 (+) 573 WP_080478339.1 signal peptidase I -
  AACH71_RS00565 (BSB_01110) tasA 94635..95420 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  AACH71_RS00570 (BSB_01120) sinR 95514..95849 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AACH71_RS00575 (BSB_01130) sinI 95883..96056 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 126 a.a.        Molecular weight: 14174.31 Da        Isoelectric Point: 6.7499

>NTDB_id=108235 AACH71_RS00535 WP_014664591.1 91615..91995(+) (comGF) [Bacillus stercoris strain BST19]
MLISGSLATIFHLFLSRQQEHGGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEVYHSMVRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEKKVYQTSFPVYSYLGGG

Nucleotide


Download         Length: 381 bp        

>NTDB_id=108235 AACH71_RS00535 WP_014664591.1 91615..91995(+) (comGF) [Bacillus stercoris strain BST19]
TTGCTCATATCAGGATCGTTAGCGACGATTTTCCATCTGTTTTTATCTCGACAGCAGGAGCATGGCGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TTTTAATTTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGAAGTTTATCATTCTATGGTAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCCATTTTAGATCATATTACAGCTATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGAAAAAAGTGTATCAAACTTCTTTTCCGGTTTATTCGTATTTAGGAGGAGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-110)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

92.913

100

0.937

Multiple sequence alignment