Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACK2WG_RS12255 Genome accession   NZ_CP176536
Coordinates   2424677..2425051 (-) Length   124 a.a.
NCBI ID   WP_072183695.1    Uniprot ID   -
Organism   Bacillus spizizenii strain 29-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2419677..2430051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2WG_RS12215 (ACK2WG_12215) - 2420005..2420799 (+) 795 WP_072566542.1 YqhG family protein -
  ACK2WG_RS12220 (ACK2WG_12220) sinI 2420985..2421158 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  ACK2WG_RS12225 (ACK2WG_12225) sinR 2421192..2421527 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACK2WG_RS12230 (ACK2WG_12230) tasA 2421621..2422406 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  ACK2WG_RS12235 (ACK2WG_12235) sipW 2422470..2423042 (-) 573 WP_014114391.1 signal peptidase I SipW -
  ACK2WG_RS12240 (ACK2WG_12240) tapA 2423026..2423787 (-) 762 WP_072566543.1 amyloid fiber anchoring/assembly protein TapA -
  ACK2WG_RS12245 (ACK2WG_12245) - 2424058..2424384 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  ACK2WG_RS12250 (ACK2WG_12250) - 2424426..2424605 (-) 180 WP_003226330.1 YqzE family protein -
  ACK2WG_RS12255 (ACK2WG_12255) comGG 2424677..2425051 (-) 375 WP_072183695.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACK2WG_RS12260 (ACK2WG_12260) comGF 2425052..2425435 (-) 384 WP_041520999.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACK2WG_RS12265 (ACK2WG_12265) comGE 2425461..2425808 (-) 348 WP_242733998.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACK2WG_RS12270 (ACK2WG_12270) comGD 2425792..2426223 (-) 432 WP_014114399.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACK2WG_RS12275 (ACK2WG_12275) comGC 2426213..2426509 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  ACK2WG_RS12280 (ACK2WG_12280) comGB 2426523..2427560 (-) 1038 WP_014114401.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACK2WG_RS12285 (ACK2WG_12285) comGA 2427547..2428617 (-) 1071 WP_072183690.1 competence protein ComGA Machinery gene
  ACK2WG_RS12290 (ACK2WG_12290) - 2428831..2429241 (-) 411 WP_014114403.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14329.41 Da        Isoelectric Point: 7.9624

>NTDB_id=1080783 ACK2WG_RS12255 WP_072183695.1 2424677..2425051(-) (comGG) [Bacillus spizizenii strain 29-4]
MDSTKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKEFYTGENLLQNGALLSIRHVLEQRKGQKDSQQFPYGQVS
YYIYDTSIKEQKEINLKALTESGTERTAQIVFDQKQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1080783 ACK2WG_RS12255 WP_072183695.1 2424677..2425051(-) (comGG) [Bacillus spizizenii strain 29-4]
ATGGACAGCACGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTGTCCGCGCTTGTGCTGCTGATCGTGAACTTTACTGC
TGCGCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGAGAGAATTTGCTTCAGAATGGCG
CGCTTCTGTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGATTCACAGCAGTTTCCATATGGGCAGGTTTCT
TATTACATTTACGATACATCGATAAAAGAGCAAAAAGAAATCAACCTAAAAGCGTTGACGGAGTCGGGAACAGAAAGAAC
TGCACAGATTGTGTTTGATCAAAAACAGAAAAAACTGCTGAGCTGGACAGAATAG

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

84.677

100

0.847

Multiple sequence alignment