Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACK2WG_RS12220 Genome accession   NZ_CP176536
Coordinates   2420985..2421158 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii strain 29-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2415985..2426158
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2WG_RS12205 (ACK2WG_12205) gcvT 2416780..2417868 (-) 1089 WP_072183732.1 glycine cleavage system aminomethyltransferase GcvT -
  ACK2WG_RS12210 (ACK2WG_12210) - 2418311..2419984 (+) 1674 WP_072566541.1 DEAD/DEAH box helicase -
  ACK2WG_RS12215 (ACK2WG_12215) - 2420005..2420799 (+) 795 WP_072566542.1 YqhG family protein -
  ACK2WG_RS12220 (ACK2WG_12220) sinI 2420985..2421158 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  ACK2WG_RS12225 (ACK2WG_12225) sinR 2421192..2421527 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACK2WG_RS12230 (ACK2WG_12230) tasA 2421621..2422406 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  ACK2WG_RS12235 (ACK2WG_12235) sipW 2422470..2423042 (-) 573 WP_014114391.1 signal peptidase I SipW -
  ACK2WG_RS12240 (ACK2WG_12240) tapA 2423026..2423787 (-) 762 WP_072566543.1 amyloid fiber anchoring/assembly protein TapA -
  ACK2WG_RS12245 (ACK2WG_12245) - 2424058..2424384 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  ACK2WG_RS12250 (ACK2WG_12250) - 2424426..2424605 (-) 180 WP_003226330.1 YqzE family protein -
  ACK2WG_RS12255 (ACK2WG_12255) comGG 2424677..2425051 (-) 375 WP_072183695.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACK2WG_RS12260 (ACK2WG_12260) comGF 2425052..2425435 (-) 384 WP_041520999.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACK2WG_RS12265 (ACK2WG_12265) comGE 2425461..2425808 (-) 348 WP_242733998.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=1080781 ACK2WG_RS12220 WP_003226347.1 2420985..2421158(+) (sinI) [Bacillus spizizenii strain 29-4]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1080781 ACK2WG_RS12220 WP_003226347.1 2420985..2421158(+) (sinI) [Bacillus spizizenii strain 29-4]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965

Multiple sequence alignment