Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACJ1CH_RS12015 Genome accession   NZ_CP175541
Coordinates   2509428..2509865 (-) Length   145 a.a.
NCBI ID   WP_024085600.1    Uniprot ID   -
Organism   Bacillus velezensis strain Tcba05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2504428..2514865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJ1CH_RS11965 (ACJ1CH_11965) sinI 2504812..2504985 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJ1CH_RS11970 (ACJ1CH_11970) sinR 2505019..2505354 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJ1CH_RS11975 (ACJ1CH_11975) tasA 2505402..2506187 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  ACJ1CH_RS11980 (ACJ1CH_11980) sipW 2506251..2506835 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACJ1CH_RS11985 (ACJ1CH_11985) tapA 2506807..2507478 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACJ1CH_RS11990 (ACJ1CH_11990) - 2507738..2508067 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  ACJ1CH_RS11995 (ACJ1CH_11995) - 2508107..2508286 (-) 180 WP_003153093.1 YqzE family protein -
  ACJ1CH_RS12000 (ACJ1CH_12000) comGG 2508343..2508720 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJ1CH_RS12005 (ACJ1CH_12005) comGF 2508721..2509221 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  ACJ1CH_RS12010 (ACJ1CH_12010) comGE 2509130..2509444 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJ1CH_RS12015 (ACJ1CH_12015) comGD 2509428..2509865 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJ1CH_RS12020 (ACJ1CH_12020) comGC 2509855..2510163 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJ1CH_RS12025 (ACJ1CH_12025) comGB 2510168..2511205 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJ1CH_RS12030 (ACJ1CH_12030) comGA 2511192..2512262 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJ1CH_RS12035 (ACJ1CH_12035) - 2512454..2513404 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  ACJ1CH_RS12040 (ACJ1CH_12040) - 2513550..2514851 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16302.80 Da        Isoelectric Point: 10.3354

>NTDB_id=1078045 ACJ1CH_RS12015 WP_024085600.1 2509428..2509865(-) (comGD) [Bacillus velezensis strain Tcba05]
MNNNRRTENGFTLLESLVVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSFHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1078045 ACJ1CH_RS12015 WP_024085600.1 2509428..2509865(-) (comGD) [Bacillus velezensis strain Tcba05]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCATTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment