Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACJ1CH_RS11965 | Genome accession | NZ_CP175541 |
| Coordinates | 2504812..2504985 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Tcba05 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2499812..2509985
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJ1CH_RS11950 (ACJ1CH_11950) | gcvT | 2500627..2501727 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACJ1CH_RS11955 (ACJ1CH_11955) | - | 2502153..2503823 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACJ1CH_RS11960 (ACJ1CH_11960) | - | 2503841..2504635 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACJ1CH_RS11965 (ACJ1CH_11965) | sinI | 2504812..2504985 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACJ1CH_RS11970 (ACJ1CH_11970) | sinR | 2505019..2505354 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACJ1CH_RS11975 (ACJ1CH_11975) | tasA | 2505402..2506187 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| ACJ1CH_RS11980 (ACJ1CH_11980) | sipW | 2506251..2506835 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| ACJ1CH_RS11985 (ACJ1CH_11985) | tapA | 2506807..2507478 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACJ1CH_RS11990 (ACJ1CH_11990) | - | 2507738..2508067 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| ACJ1CH_RS11995 (ACJ1CH_11995) | - | 2508107..2508286 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACJ1CH_RS12000 (ACJ1CH_12000) | comGG | 2508343..2508720 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACJ1CH_RS12005 (ACJ1CH_12005) | comGF | 2508721..2509221 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| ACJ1CH_RS12010 (ACJ1CH_12010) | comGE | 2509130..2509444 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACJ1CH_RS12015 (ACJ1CH_12015) | comGD | 2509428..2509865 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1078041 ACJ1CH_RS11965 WP_003153105.1 2504812..2504985(+) (sinI) [Bacillus velezensis strain Tcba05]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1078041 ACJ1CH_RS11965 WP_003153105.1 2504812..2504985(+) (sinI) [Bacillus velezensis strain Tcba05]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |