Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABXH30_RS16545 Genome accession   NZ_CP173259
Coordinates   3284862..3285002 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain XW38     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3279862..3290002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXH30_RS16520 (ABXH30_16520) - 3280189..3280572 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ABXH30_RS16525 (ABXH30_16525) comA 3280594..3281238 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ABXH30_RS16530 (ABXH30_16530) comP 3281319..3283625 (-) 2307 WP_044052948.1 sensor histidine kinase Regulator
  ABXH30_RS16535 (ABXH30_16535) comX 3283644..3283820 (-) 177 WP_044052947.1 competence pheromone ComX -
  ABXH30_RS16540 (ABXH30_16540) - 3283835..3284710 (-) 876 WP_026092320.1 polyprenyl synthetase family protein -
  ABXH30_RS16545 (ABXH30_16545) degQ 3284862..3285002 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABXH30_RS16550 (ABXH30_16550) - 3285468..3285809 (+) 342 WP_003152040.1 hypothetical protein -
  ABXH30_RS16555 (ABXH30_16555) - 3285816..3287036 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ABXH30_RS16560 (ABXH30_16560) - 3287166..3288632 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ABXH30_RS16565 (ABXH30_16565) - 3288650..3289201 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ABXH30_RS16570 (ABXH30_16570) - 3289298..3289696 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1071197 ABXH30_RS16545 WP_003152043.1 3284862..3285002(-) (degQ) [Bacillus velezensis strain XW38]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1071197 ABXH30_RS16545 WP_003152043.1 3284862..3285002(-) (degQ) [Bacillus velezensis strain XW38]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment