Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACHD8M_RS12625 Genome accession   NZ_CP171807
Coordinates   2537820..2538257 (-) Length   145 a.a.
NCBI ID   WP_159354373.1    Uniprot ID   -
Organism   Bacillus velezensis strain BRI3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2532820..2543257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHD8M_RS12575 sinI 2533203..2533376 (+) 174 WP_159354372.1 anti-repressor SinI Regulator
  ACHD8M_RS12580 sinR 2533410..2533745 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACHD8M_RS12585 tasA 2533793..2534578 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  ACHD8M_RS12590 sipW 2534643..2535227 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACHD8M_RS12595 tapA 2535199..2535870 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACHD8M_RS12600 - 2536129..2536458 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACHD8M_RS12605 - 2536499..2536678 (-) 180 WP_003153093.1 YqzE family protein -
  ACHD8M_RS12610 comGG 2536735..2537112 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACHD8M_RS12615 comGF 2537113..2537508 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  ACHD8M_RS12620 comGE 2537522..2537836 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHD8M_RS12625 comGD 2537820..2538257 (-) 438 WP_159354373.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACHD8M_RS12630 comGC 2538247..2538555 (-) 309 WP_159354374.1 competence type IV pilus major pilin ComGC Machinery gene
  ACHD8M_RS12635 comGB 2538560..2539597 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACHD8M_RS12640 comGA 2539584..2540654 (-) 1071 WP_159354375.1 competence type IV pilus ATPase ComGA Machinery gene
  ACHD8M_RS12645 - 2540847..2541797 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  ACHD8M_RS12650 - 2541943..2543244 (+) 1302 WP_007408318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16268.74 Da        Isoelectric Point: 10.0367

>NTDB_id=1064345 ACHD8M_RS12625 WP_159354373.1 2537820..2538257(-) (comGD) [Bacillus velezensis strain BRI3]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLVVRQKTEQLQKDIQLAQETAIAEHNRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1064345 ACHD8M_RS12625 WP_159354373.1 2537820..2538257(-) (comGD) [Bacillus velezensis strain BRI3]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGTCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAATAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment