Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACHD8M_RS12575 | Genome accession | NZ_CP171807 |
| Coordinates | 2533203..2533376 (+) | Length | 57 a.a. |
| NCBI ID | WP_159354372.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain BRI3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2528203..2538376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACHD8M_RS12560 | gcvT | 2529016..2530116 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACHD8M_RS12565 | - | 2530540..2532210 (+) | 1671 | WP_038461530.1 | DEAD/DEAH box helicase | - |
| ACHD8M_RS12570 | - | 2532232..2533026 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ACHD8M_RS12575 | sinI | 2533203..2533376 (+) | 174 | WP_159354372.1 | anti-repressor SinI | Regulator |
| ACHD8M_RS12580 | sinR | 2533410..2533745 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACHD8M_RS12585 | tasA | 2533793..2534578 (-) | 786 | WP_017418136.1 | biofilm matrix protein TasA | - |
| ACHD8M_RS12590 | sipW | 2534643..2535227 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACHD8M_RS12595 | tapA | 2535199..2535870 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACHD8M_RS12600 | - | 2536129..2536458 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACHD8M_RS12605 | - | 2536499..2536678 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACHD8M_RS12610 | comGG | 2536735..2537112 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACHD8M_RS12615 | comGF | 2537113..2537508 (-) | 396 | WP_021494311.1 | competence type IV pilus minor pilin ComGF | - |
| ACHD8M_RS12620 | comGE | 2537522..2537836 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACHD8M_RS12625 | comGD | 2537820..2538257 (-) | 438 | WP_159354373.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6570.53 Da Isoelectric Point: 10.2093
>NTDB_id=1064341 ACHD8M_RS12575 WP_159354372.1 2533203..2533376(+) (sinI) [Bacillus velezensis strain BRI3]
MKNAKTGFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTGFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1064341 ACHD8M_RS12575 WP_159354372.1 2533203..2533376(+) (sinI) [Bacillus velezensis strain BRI3]
ATGAAAAATGCAAAAACAGGATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGGATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |