Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACHD8M_RS12575 Genome accession   NZ_CP171807
Coordinates   2533203..2533376 (+) Length   57 a.a.
NCBI ID   WP_159354372.1    Uniprot ID   -
Organism   Bacillus velezensis strain BRI3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2528203..2538376
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHD8M_RS12560 gcvT 2529016..2530116 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  ACHD8M_RS12565 - 2530540..2532210 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  ACHD8M_RS12570 - 2532232..2533026 (+) 795 WP_014418368.1 YqhG family protein -
  ACHD8M_RS12575 sinI 2533203..2533376 (+) 174 WP_159354372.1 anti-repressor SinI Regulator
  ACHD8M_RS12580 sinR 2533410..2533745 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACHD8M_RS12585 tasA 2533793..2534578 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  ACHD8M_RS12590 sipW 2534643..2535227 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACHD8M_RS12595 tapA 2535199..2535870 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACHD8M_RS12600 - 2536129..2536458 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACHD8M_RS12605 - 2536499..2536678 (-) 180 WP_003153093.1 YqzE family protein -
  ACHD8M_RS12610 comGG 2536735..2537112 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACHD8M_RS12615 comGF 2537113..2537508 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  ACHD8M_RS12620 comGE 2537522..2537836 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHD8M_RS12625 comGD 2537820..2538257 (-) 438 WP_159354373.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6570.53 Da        Isoelectric Point: 10.2093

>NTDB_id=1064341 ACHD8M_RS12575 WP_159354372.1 2533203..2533376(+) (sinI) [Bacillus velezensis strain BRI3]
MKNAKTGFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1064341 ACHD8M_RS12575 WP_159354372.1 2533203..2533376(+) (sinI) [Bacillus velezensis strain BRI3]
ATGAAAAATGCAAAAACAGGATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment