Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACHD8M_RS12620 Genome accession   NZ_CP171807
Coordinates   2537522..2537836 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain BRI3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2532522..2542836
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHD8M_RS12575 sinI 2533203..2533376 (+) 174 WP_159354372.1 anti-repressor SinI Regulator
  ACHD8M_RS12580 sinR 2533410..2533745 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACHD8M_RS12585 tasA 2533793..2534578 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  ACHD8M_RS12590 sipW 2534643..2535227 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACHD8M_RS12595 tapA 2535199..2535870 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACHD8M_RS12600 - 2536129..2536458 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACHD8M_RS12605 - 2536499..2536678 (-) 180 WP_003153093.1 YqzE family protein -
  ACHD8M_RS12610 comGG 2536735..2537112 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACHD8M_RS12615 comGF 2537113..2537508 (-) 396 WP_021494311.1 competence type IV pilus minor pilin ComGF -
  ACHD8M_RS12620 comGE 2537522..2537836 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHD8M_RS12625 comGD 2537820..2538257 (-) 438 WP_159354373.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACHD8M_RS12630 comGC 2538247..2538555 (-) 309 WP_159354374.1 competence type IV pilus major pilin ComGC Machinery gene
  ACHD8M_RS12635 comGB 2538560..2539597 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACHD8M_RS12640 comGA 2539584..2540654 (-) 1071 WP_159354375.1 competence type IV pilus ATPase ComGA Machinery gene
  ACHD8M_RS12645 - 2540847..2541797 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=1064344 ACHD8M_RS12620 WP_017418140.1 2537522..2537836(-) (comGE) [Bacillus velezensis strain BRI3]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1064344 ACHD8M_RS12620 WP_017418140.1 2537522..2537836(-) (comGE) [Bacillus velezensis strain BRI3]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCAGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment