Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AABA14_RS02585 Genome accession   NZ_AP028607
Coordinates   492627..492776 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Sep2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 487627..497776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA14_RS02555 (TKY123642_04910) blpC 487888..488043 (-) 156 WP_000358814.1 quorum-sensing system pheromone BlpC -
  AABA14_RS02560 (TKY123642_04920) - 488100..489461 (-) 1362 WP_061764626.1 bacteriocin secretion accessory protein -
  AABA14_RS02565 (TKY123642_04930) comA/nlmT 489472..491148 (-) 1677 WP_338168497.1 peptide cleavage/export ABC transporter Regulator
  AABA14_RS02570 (TKY123642_04940) comA/nlmT 491042..491629 (-) 588 WP_050111533.1 cysteine peptidase family C39 domain-containing protein Regulator
  AABA14_RS02575 (TKY123642_04950) blpM 491910..492164 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AABA14_RS02580 (TKY123642_04960) blpN 492180..492383 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AABA14_RS02585 (TKY123642_04970) cipB 492627..492776 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AABA14_RS02590 - 492880..492999 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AABA14_RS02595 (TKY123642_04990) - 493785..494168 (+) 384 WP_016398494.1 hypothetical protein -
  AABA14_RS02600 (TKY123642_05000) - 494220..494909 (+) 690 WP_050220778.1 CPBP family intramembrane glutamic endopeptidase -
  AABA14_RS02605 blpZ 495016..495183 (+) 168 WP_309543760.1 immunity protein BlpZ -
  AABA14_RS02610 - 495334..495945 (+) 612 WP_044814721.1 type II CAAX endopeptidase family protein -
  AABA14_RS02615 (TKY123642_05010) - 496107..496901 (+) 795 WP_000363002.1 phosphotransferase family protein -
  AABA14_RS02620 (TKY123642_05020) trmB 496898..497533 (+) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=106265 AABA14_RS02585 WP_001818346.1 492627..492776(+) (cipB) [Streptococcus pneumoniae strain Sep2]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=106265 AABA14_RS02585 WP_001818346.1 492627..492776(+) (cipB) [Streptococcus pneumoniae strain Sep2]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment