Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACFXAD_RS05740 Genome accession   NZ_CP170653
Coordinates   1136358..1136498 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain JP5011     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1131358..1141498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAD_RS05715 (ACFXAD_05715) - 1131664..1132062 (+) 399 WP_003152031.1 YueI family protein -
  ACFXAD_RS05720 (ACFXAD_05720) - 1132159..1132710 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACFXAD_RS05725 (ACFXAD_05725) - 1132728..1134194 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACFXAD_RS05730 (ACFXAD_05730) - 1134324..1135547 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACFXAD_RS05735 (ACFXAD_05735) - 1135554..1135895 (-) 342 WP_007408677.1 hypothetical protein -
  ACFXAD_RS05740 (ACFXAD_05740) degQ 1136358..1136498 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACFXAD_RS05745 (ACFXAD_05745) comQ 1136629..1137615 (+) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACFXAD_RS05750 (ACFXAD_05750) comP 1137768..1140071 (+) 2304 WP_040238945.1 histidine kinase Regulator
  ACFXAD_RS05755 (ACFXAD_05755) comA 1140152..1140796 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACFXAD_RS05760 (ACFXAD_05760) - 1140818..1141201 (+) 384 WP_053574130.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1058473 ACFXAD_RS05740 WP_003152043.1 1136358..1136498(+) (degQ) [Bacillus amyloliquefaciens strain JP5011]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1058473 ACFXAD_RS05740 WP_003152043.1 1136358..1136498(+) (degQ) [Bacillus amyloliquefaciens strain JP5011]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment