Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFXAB_RS10940 | Genome accession | NZ_CP170650 |
| Coordinates | 2138347..2138520 (-) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain JP5039 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2133347..2143520
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFXAB_RS10890 (ACFXAB_10890) | comGD | 2133466..2133903 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACFXAB_RS10895 (ACFXAB_10895) | comGE | 2133887..2134201 (+) | 315 | WP_032863566.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACFXAB_RS10900 (ACFXAB_10900) | comGF | 2134215..2134610 (+) | 396 | WP_014721501.1 | competence type IV pilus minor pilin ComGF | - |
| ACFXAB_RS10905 (ACFXAB_10905) | comGG | 2134611..2134988 (+) | 378 | WP_014418373.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFXAB_RS10910 (ACFXAB_10910) | - | 2135045..2135224 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFXAB_RS10915 (ACFXAB_10915) | - | 2135265..2135594 (-) | 330 | WP_014418372.1 | DUF3889 domain-containing protein | - |
| ACFXAB_RS10920 (ACFXAB_10920) | tapA | 2135853..2136524 (+) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFXAB_RS10925 (ACFXAB_10925) | sipW | 2136496..2137080 (+) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| ACFXAB_RS10930 (ACFXAB_10930) | tasA | 2137145..2137930 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFXAB_RS10935 (ACFXAB_10935) | sinR | 2137978..2138313 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFXAB_RS10940 (ACFXAB_10940) | sinI | 2138347..2138520 (-) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| ACFXAB_RS10945 (ACFXAB_10945) | - | 2138697..2139491 (-) | 795 | WP_014418368.1 | YqhG family protein | - |
| ACFXAB_RS10950 (ACFXAB_10950) | - | 2139513..2141183 (-) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| ACFXAB_RS10955 (ACFXAB_10955) | gcvT | 2141607..2142707 (+) | 1101 | WP_014418366.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1058350 ACFXAB_RS10940 WP_014418369.1 2138347..2138520(-) (sinI) [Bacillus velezensis strain JP5039]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1058350 ACFXAB_RS10940 WP_014418369.1 2138347..2138520(-) (sinI) [Bacillus velezensis strain JP5039]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |