Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFXAB_RS10940 Genome accession   NZ_CP170650
Coordinates   2138347..2138520 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain JP5039     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2133347..2143520
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAB_RS10890 (ACFXAB_10890) comGD 2133466..2133903 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAB_RS10895 (ACFXAB_10895) comGE 2133887..2134201 (+) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAB_RS10900 (ACFXAB_10900) comGF 2134215..2134610 (+) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  ACFXAB_RS10905 (ACFXAB_10905) comGG 2134611..2134988 (+) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAB_RS10910 (ACFXAB_10910) - 2135045..2135224 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAB_RS10915 (ACFXAB_10915) - 2135265..2135594 (-) 330 WP_014418372.1 DUF3889 domain-containing protein -
  ACFXAB_RS10920 (ACFXAB_10920) tapA 2135853..2136524 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAB_RS10925 (ACFXAB_10925) sipW 2136496..2137080 (+) 585 WP_014418370.1 signal peptidase I SipW -
  ACFXAB_RS10930 (ACFXAB_10930) tasA 2137145..2137930 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAB_RS10935 (ACFXAB_10935) sinR 2137978..2138313 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAB_RS10940 (ACFXAB_10940) sinI 2138347..2138520 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACFXAB_RS10945 (ACFXAB_10945) - 2138697..2139491 (-) 795 WP_014418368.1 YqhG family protein -
  ACFXAB_RS10950 (ACFXAB_10950) - 2139513..2141183 (-) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  ACFXAB_RS10955 (ACFXAB_10955) gcvT 2141607..2142707 (+) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=1058350 ACFXAB_RS10940 WP_014418369.1 2138347..2138520(-) (sinI) [Bacillus velezensis strain JP5039]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1058350 ACFXAB_RS10940 WP_014418369.1 2138347..2138520(-) (sinI) [Bacillus velezensis strain JP5039]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment