Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACFXAB_RS10895 Genome accession   NZ_CP170650
Coordinates   2133887..2134201 (+) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain JP5039     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2128887..2139201
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAB_RS10870 (ACFXAB_10870) - 2129926..2130876 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  ACFXAB_RS10875 (ACFXAB_10875) comGA 2131069..2132139 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFXAB_RS10880 (ACFXAB_10880) comGB 2132126..2133163 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFXAB_RS10885 (ACFXAB_10885) comGC 2133168..2133476 (+) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFXAB_RS10890 (ACFXAB_10890) comGD 2133466..2133903 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAB_RS10895 (ACFXAB_10895) comGE 2133887..2134201 (+) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAB_RS10900 (ACFXAB_10900) comGF 2134215..2134610 (+) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  ACFXAB_RS10905 (ACFXAB_10905) comGG 2134611..2134988 (+) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAB_RS10910 (ACFXAB_10910) - 2135045..2135224 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAB_RS10915 (ACFXAB_10915) - 2135265..2135594 (-) 330 WP_014418372.1 DUF3889 domain-containing protein -
  ACFXAB_RS10920 (ACFXAB_10920) tapA 2135853..2136524 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAB_RS10925 (ACFXAB_10925) sipW 2136496..2137080 (+) 585 WP_014418370.1 signal peptidase I SipW -
  ACFXAB_RS10930 (ACFXAB_10930) tasA 2137145..2137930 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAB_RS10935 (ACFXAB_10935) sinR 2137978..2138313 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAB_RS10940 (ACFXAB_10940) sinI 2138347..2138520 (-) 174 WP_014418369.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=1058347 ACFXAB_RS10895 WP_032863566.1 2133887..2134201(+) (comGE) [Bacillus velezensis strain JP5039]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1058347 ACFXAB_RS10895 WP_032863566.1 2133887..2134201(+) (comGE) [Bacillus velezensis strain JP5039]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49


Multiple sequence alignment