Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACEZ45_RS11920 | Genome accession | NZ_CP169877 |
| Coordinates | 2467915..2468088 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JF | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2462915..2473088
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEZ45_RS11905 (ACEZ45_11905) | gcvT | 2463733..2464833 (-) | 1101 | WP_069473502.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACEZ45_RS11910 (ACEZ45_11910) | - | 2465256..2466926 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACEZ45_RS11915 (ACEZ45_11915) | - | 2466944..2467738 (+) | 795 | WP_069473503.1 | YqhG family protein | - |
| ACEZ45_RS11920 (ACEZ45_11920) | sinI | 2467915..2468088 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACEZ45_RS11925 (ACEZ45_11925) | sinR | 2468122..2468457 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACEZ45_RS11930 (ACEZ45_11930) | tasA | 2468505..2469290 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACEZ45_RS11935 (ACEZ45_11935) | sipW | 2469354..2469938 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| ACEZ45_RS11940 (ACEZ45_11940) | tapA | 2469910..2470581 (-) | 672 | WP_046341384.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACEZ45_RS11945 (ACEZ45_11945) | - | 2470840..2471169 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACEZ45_RS11950 (ACEZ45_11950) | - | 2471209..2471388 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACEZ45_RS11955 (ACEZ45_11955) | comGG | 2471445..2471822 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACEZ45_RS11960 (ACEZ45_11960) | comGF | 2471823..2472218 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| ACEZ45_RS11965 (ACEZ45_11965) | comGE | 2472232..2472546 (-) | 315 | WP_046341385.1 | competence type IV pilus minor pilin ComGE | - |
| ACEZ45_RS11970 (ACEZ45_11970) | comGD | 2472530..2472967 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1053975 ACEZ45_RS11920 WP_003153105.1 2467915..2468088(+) (sinI) [Bacillus amyloliquefaciens strain JF]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1053975 ACEZ45_RS11920 WP_003153105.1 2467915..2468088(+) (sinI) [Bacillus amyloliquefaciens strain JF]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |