Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACEZ45_RS11920 Genome accession   NZ_CP169877
Coordinates   2467915..2468088 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JF     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2462915..2473088
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEZ45_RS11905 (ACEZ45_11905) gcvT 2463733..2464833 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  ACEZ45_RS11910 (ACEZ45_11910) - 2465256..2466926 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACEZ45_RS11915 (ACEZ45_11915) - 2466944..2467738 (+) 795 WP_069473503.1 YqhG family protein -
  ACEZ45_RS11920 (ACEZ45_11920) sinI 2467915..2468088 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACEZ45_RS11925 (ACEZ45_11925) sinR 2468122..2468457 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEZ45_RS11930 (ACEZ45_11930) tasA 2468505..2469290 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACEZ45_RS11935 (ACEZ45_11935) sipW 2469354..2469938 (-) 585 WP_003153100.1 signal peptidase I SipW -
  ACEZ45_RS11940 (ACEZ45_11940) tapA 2469910..2470581 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  ACEZ45_RS11945 (ACEZ45_11945) - 2470840..2471169 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACEZ45_RS11950 (ACEZ45_11950) - 2471209..2471388 (-) 180 WP_003153093.1 YqzE family protein -
  ACEZ45_RS11955 (ACEZ45_11955) comGG 2471445..2471822 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEZ45_RS11960 (ACEZ45_11960) comGF 2471823..2472218 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  ACEZ45_RS11965 (ACEZ45_11965) comGE 2472232..2472546 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  ACEZ45_RS11970 (ACEZ45_11970) comGD 2472530..2472967 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1053975 ACEZ45_RS11920 WP_003153105.1 2467915..2468088(+) (sinI) [Bacillus amyloliquefaciens strain JF]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1053975 ACEZ45_RS11920 WP_003153105.1 2467915..2468088(+) (sinI) [Bacillus amyloliquefaciens strain JF]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment