Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACEPM6_RS08735 Genome accession   NZ_CP169570
Coordinates   1779636..1780013 (-) Length   125 a.a.
NCBI ID   WP_022552965.1    Uniprot ID   -
Organism   Bacillus velezensis strain CIMT3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1774636..1785013
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEPM6_RS08695 (ACEPM6_08695) - 1775133..1775927 (+) 795 WP_014418368.1 YqhG family protein -
  ACEPM6_RS08700 (ACEPM6_08700) sinI 1776104..1776277 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACEPM6_RS08705 (ACEPM6_08705) sinR 1776311..1776646 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEPM6_RS08710 (ACEPM6_08710) tasA 1776694..1777479 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACEPM6_RS08715 (ACEPM6_08715) sipW 1777544..1778128 (-) 585 WP_022552967.1 signal peptidase I SipW -
  ACEPM6_RS08720 (ACEPM6_08720) tapA 1778100..1778771 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACEPM6_RS08725 (ACEPM6_08725) - 1779030..1779359 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACEPM6_RS08730 (ACEPM6_08730) - 1779400..1779579 (-) 180 WP_022552966.1 YqzE family protein -
  ACEPM6_RS08735 (ACEPM6_08735) comGG 1779636..1780013 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEPM6_RS08740 (ACEPM6_08740) comGF 1780014..1780409 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACEPM6_RS08745 (ACEPM6_08745) comGE 1780423..1780737 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACEPM6_RS08750 (ACEPM6_08750) comGD 1780721..1781158 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACEPM6_RS08755 (ACEPM6_08755) comGC 1781148..1781456 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ACEPM6_RS08760 (ACEPM6_08760) comGB 1781461..1782498 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACEPM6_RS08765 (ACEPM6_08765) comGA 1782485..1783555 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  ACEPM6_RS08770 (ACEPM6_08770) - 1783748..1784698 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14207.16 Da        Isoelectric Point: 9.9338

>NTDB_id=1052321 ACEPM6_RS08735 WP_022552965.1 1779636..1780013(-) (comGG) [Bacillus velezensis strain CIMT3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETKTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1052321 ACEPM6_RS08735 WP_022552965.1 1779636..1780013(-) (comGG) [Bacillus velezensis strain CIMT3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCAAGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment