Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACEPM6_RS08700 Genome accession   NZ_CP169570
Coordinates   1776104..1776277 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain CIMT3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1771104..1781277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEPM6_RS08685 (ACEPM6_08685) gcvT 1771917..1773017 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  ACEPM6_RS08690 (ACEPM6_08690) - 1773441..1775111 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  ACEPM6_RS08695 (ACEPM6_08695) - 1775133..1775927 (+) 795 WP_014418368.1 YqhG family protein -
  ACEPM6_RS08700 (ACEPM6_08700) sinI 1776104..1776277 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACEPM6_RS08705 (ACEPM6_08705) sinR 1776311..1776646 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEPM6_RS08710 (ACEPM6_08710) tasA 1776694..1777479 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACEPM6_RS08715 (ACEPM6_08715) sipW 1777544..1778128 (-) 585 WP_022552967.1 signal peptidase I SipW -
  ACEPM6_RS08720 (ACEPM6_08720) tapA 1778100..1778771 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACEPM6_RS08725 (ACEPM6_08725) - 1779030..1779359 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACEPM6_RS08730 (ACEPM6_08730) - 1779400..1779579 (-) 180 WP_022552966.1 YqzE family protein -
  ACEPM6_RS08735 (ACEPM6_08735) comGG 1779636..1780013 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEPM6_RS08740 (ACEPM6_08740) comGF 1780014..1780409 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACEPM6_RS08745 (ACEPM6_08745) comGE 1780423..1780737 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACEPM6_RS08750 (ACEPM6_08750) comGD 1780721..1781158 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=1052319 ACEPM6_RS08700 WP_014418369.1 1776104..1776277(+) (sinI) [Bacillus velezensis strain CIMT3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1052319 ACEPM6_RS08700 WP_014418369.1 1776104..1776277(+) (sinI) [Bacillus velezensis strain CIMT3]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterProScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment