Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACEX67_RS11740 | Genome accession | NZ_CP169520 |
| Coordinates | 2460515..2460688 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CX-H3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2455515..2465688
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEX67_RS11725 (ACEX67_11725) | gcvT | 2456333..2457433 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACEX67_RS11730 (ACEX67_11730) | - | 2457856..2459526 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACEX67_RS11735 (ACEX67_11735) | - | 2459544..2460338 (+) | 795 | WP_240679748.1 | YqhG family protein | - |
| ACEX67_RS11740 (ACEX67_11740) | sinI | 2460515..2460688 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACEX67_RS11745 (ACEX67_11745) | sinR | 2460722..2461057 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACEX67_RS11750 (ACEX67_11750) | tasA | 2461105..2461890 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACEX67_RS11755 (ACEX67_11755) | sipW | 2461954..2462538 (-) | 585 | WP_240679749.1 | signal peptidase I SipW | - |
| ACEX67_RS11760 (ACEX67_11760) | tapA | 2462510..2463181 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACEX67_RS11765 (ACEX67_11765) | - | 2463440..2463769 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACEX67_RS11770 (ACEX67_11770) | - | 2463809..2463988 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACEX67_RS11775 (ACEX67_11775) | comGG | 2464045..2464422 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACEX67_RS11780 (ACEX67_11780) | comGF | 2464423..2464923 (-) | 501 | WP_235570156.1 | competence type IV pilus minor pilin ComGF | - |
| ACEX67_RS11785 (ACEX67_11785) | comGE | 2464832..2465146 (-) | 315 | WP_057080485.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACEX67_RS11790 (ACEX67_11790) | comGD | 2465130..2465567 (-) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1051654 ACEX67_RS11740 WP_003153105.1 2460515..2460688(+) (sinI) [Bacillus velezensis strain CX-H3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1051654 ACEX67_RS11740 WP_003153105.1 2460515..2460688(+) (sinI) [Bacillus velezensis strain CX-H3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |