Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACEX67_RS11785 Genome accession   NZ_CP169520
Coordinates   2464832..2465146 (-) Length   104 a.a.
NCBI ID   WP_057080485.1    Uniprot ID   -
Organism   Bacillus velezensis strain CX-H3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2459832..2470146
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEX67_RS11740 (ACEX67_11740) sinI 2460515..2460688 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACEX67_RS11745 (ACEX67_11745) sinR 2460722..2461057 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEX67_RS11750 (ACEX67_11750) tasA 2461105..2461890 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACEX67_RS11755 (ACEX67_11755) sipW 2461954..2462538 (-) 585 WP_240679749.1 signal peptidase I SipW -
  ACEX67_RS11760 (ACEX67_11760) tapA 2462510..2463181 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  ACEX67_RS11765 (ACEX67_11765) - 2463440..2463769 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACEX67_RS11770 (ACEX67_11770) - 2463809..2463988 (-) 180 WP_003153093.1 YqzE family protein -
  ACEX67_RS11775 (ACEX67_11775) comGG 2464045..2464422 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEX67_RS11780 (ACEX67_11780) comGF 2464423..2464923 (-) 501 WP_235570156.1 competence type IV pilus minor pilin ComGF -
  ACEX67_RS11785 (ACEX67_11785) comGE 2464832..2465146 (-) 315 WP_057080485.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACEX67_RS11790 (ACEX67_11790) comGD 2465130..2465567 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACEX67_RS11795 (ACEX67_11795) comGC 2465557..2465865 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACEX67_RS11800 (ACEX67_11800) comGB 2465870..2466907 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACEX67_RS11805 (ACEX67_11805) comGA 2466894..2467964 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACEX67_RS11810 (ACEX67_11810) - 2468156..2469106 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11826.81 Da        Isoelectric Point: 6.9470

>NTDB_id=1051657 ACEX67_RS11785 WP_057080485.1 2464832..2465146(-) (comGE) [Bacillus velezensis strain CX-H3]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEICLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1051657 ACEX67_RS11785 WP_057080485.1 2464832..2465146(-) (comGE) [Bacillus velezensis strain CX-H3]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATATGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment