Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP51_RS16125 Genome accession   NZ_OX419576
Coordinates   3109221..3109361 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6105     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3104221..3114361
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP51_RS16100 (NRS6105_15970) yuxO 3104571..3104951 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP51_RS16105 (NRS6105_15975) comA 3104970..3105614 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP51_RS16110 (NRS6105_15980) comP 3105695..3107992 (-) 2298 WP_033884760.1 histidine kinase Regulator
  KJP51_RS16115 (NRS6105_15985) comX 3108000..3108161 (-) 162 WP_003228803.1 competence pheromone ComX -
  KJP51_RS16120 (NRS6105_15990) comQ 3108176..3109036 (-) 861 WP_192857944.1 polyprenyl synthetase family protein Regulator
  KJP51_RS16125 (NRS6105_15995) degQ 3109221..3109361 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP51_RS16130 - 3109583..3109708 (+) 126 WP_003228793.1 hypothetical protein -
  KJP51_RS16135 (NRS6105_16000) - 3109822..3110190 (+) 369 WP_014477834.1 hypothetical protein -
  KJP51_RS16140 (NRS6105_16005) pdeH 3110166..3111395 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  KJP51_RS16145 (NRS6105_16010) pncB 3111532..3113004 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP51_RS16150 (NRS6105_16015) pncA 3113020..3113571 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  KJP51_RS16155 (NRS6105_16020) yueI 3113668..3114066 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1040968 KJP51_RS16125 WP_003220708.1 3109221..3109361(-) (degQ) [Bacillus subtilis isolate NRS6105]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1040968 KJP51_RS16125 WP_003220708.1 3109221..3109361(-) (degQ) [Bacillus subtilis isolate NRS6105]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1