Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACCO40_RS15840 Genome accession   NZ_CP167793
Coordinates   3083117..3083257 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain SHT-15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3078117..3088257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO40_RS15815 (ACCO40_15815) - 3078471..3078851 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  ACCO40_RS15820 (ACCO40_15820) comA 3078867..3079511 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACCO40_RS15825 (ACCO40_15825) comP 3079592..3081889 (-) 2298 WP_268454382.1 histidine kinase Regulator
  ACCO40_RS15830 (ACCO40_15830) comX 3081897..3082058 (-) 162 WP_010331692.1 competence pheromone ComX -
  ACCO40_RS15835 (ACCO40_15835) - 3082072..3082932 (-) 861 WP_372401933.1 polyprenyl synthetase family protein -
  ACCO40_RS15840 (ACCO40_15840) degQ 3083117..3083257 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACCO40_RS15845 (ACCO40_15845) - 3083479..3083604 (+) 126 WP_014114985.1 hypothetical protein -
  ACCO40_RS15850 (ACCO40_15850) - 3083719..3084087 (+) 369 WP_014114986.1 hypothetical protein -
  ACCO40_RS15855 (ACCO40_15855) pdeH 3084063..3085292 (-) 1230 WP_014114987.1 cyclic di-GMP phosphodiesterase -
  ACCO40_RS15860 (ACCO40_15860) - 3085428..3086900 (-) 1473 WP_014114988.1 nicotinate phosphoribosyltransferase -
  ACCO40_RS15865 (ACCO40_15865) - 3086916..3087467 (-) 552 WP_372401936.1 cysteine hydrolase family protein -
  ACCO40_RS15870 (ACCO40_15870) - 3087564..3087962 (-) 399 WP_014114990.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1039444 ACCO40_RS15840 WP_003220708.1 3083117..3083257(-) (degQ) [Bacillus spizizenii strain SHT-15]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1039444 ACCO40_RS15840 WP_003220708.1 3083117..3083257(-) (degQ) [Bacillus spizizenii strain SHT-15]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment