Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ACB089_RS08220 Genome accession   NZ_CP167122
Coordinates   1632379..1632888 (+) Length   169 a.a.
NCBI ID   WP_374965986.1    Uniprot ID   -
Organism   Lysinibacillus sp. RS10     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1624212..1664611 1632379..1632888 within 0


Gene organization within MGE regions


Location: 1624212..1664611
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB089_RS08160 (ACB089_08155) - 1624212..1625627 (-) 1416 WP_374965974.1 recombinase family protein -
  ACB089_RS08165 (ACB089_08160) - 1625705..1626325 (-) 621 WP_374965975.1 LexA family protein -
  ACB089_RS08170 (ACB089_08165) - 1626481..1626762 (+) 282 WP_375122140.1 helix-turn-helix domain-containing protein -
  ACB089_RS08175 (ACB089_08170) - 1627131..1627622 (+) 492 WP_374965977.1 hypothetical protein -
  ACB089_RS08180 (ACB089_08175) - 1627619..1627876 (+) 258 WP_374965978.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  ACB089_RS08185 (ACB089_08180) - 1627885..1628064 (+) 180 WP_374965979.1 hypothetical protein -
  ACB089_RS08190 (ACB089_08185) - 1628061..1628942 (+) 882 WP_374965980.1 hypothetical protein -
  ACB089_RS08195 (ACB089_08190) - 1628911..1629711 (+) 801 WP_374965981.1 PD-(D/E)XK nuclease-like domain-containing protein -
  ACB089_RS08200 (ACB089_08195) - 1629723..1630568 (+) 846 WP_374965982.1 phage replisome organizer N-terminal domain-containing protein -
  ACB089_RS08205 (ACB089_08200) - 1630568..1631803 (+) 1236 WP_374965983.1 replicative DNA helicase -
  ACB089_RS08210 (ACB089_08205) - 1631790..1632224 (+) 435 WP_374965984.1 hypothetical protein -
  ACB089_RS08215 (ACB089_08210) - 1632231..1632386 (+) 156 WP_374965985.1 hypothetical protein -
  ACB089_RS08220 (ACB089_08215) ssbA 1632379..1632888 (+) 510 WP_374965986.1 single-stranded DNA-binding protein Machinery gene
  ACB089_RS08225 (ACB089_08220) - 1632906..1633367 (+) 462 WP_374965987.1 RusA family crossover junction endodeoxyribonuclease -
  ACB089_RS08230 (ACB089_08225) - 1633385..1633795 (+) 411 WP_374965988.1 hypothetical protein -
  ACB089_RS08235 (ACB089_08230) - 1634168..1634362 (+) 195 WP_374965989.1 hypothetical protein -
  ACB089_RS08240 (ACB089_08235) - 1634643..1635152 (-) 510 WP_374965990.1 DUF3231 family protein -
  ACB089_RS08245 (ACB089_08240) - 1635872..1636270 (+) 399 WP_374965991.1 hypothetical protein -
  ACB089_RS08250 (ACB089_08245) - 1636472..1636708 (+) 237 WP_374965992.1 hypothetical protein -
  ACB089_RS08255 (ACB089_08250) - 1636817..1637041 (+) 225 WP_374965993.1 type II toxin-antitoxin system HicA family toxin -
  ACB089_RS08260 (ACB089_08255) - 1637081..1637422 (+) 342 WP_374965994.1 type II toxin-antitoxin system HicB family antitoxin -
  ACB089_RS08265 (ACB089_08260) - 1637525..1637707 (+) 183 WP_374965995.1 hypothetical protein -
  ACB089_RS08270 (ACB089_08265) - 1637772..1638161 (+) 390 WP_374967524.1 HNH endonuclease -
  ACB089_RS08275 (ACB089_08270) - 1638246..1638707 (+) 462 WP_374965996.1 phage terminase small subunit P27 family -
  ACB089_RS08280 (ACB089_08275) - 1638704..1640383 (+) 1680 WP_374965997.1 terminase large subunit -
  ACB089_RS08285 (ACB089_08280) - 1640396..1641646 (+) 1251 WP_374965998.1 phage portal protein -
  ACB089_RS08290 (ACB089_08285) - 1641636..1642247 (+) 612 WP_374965999.1 HK97 family phage prohead protease -
  ACB089_RS08295 (ACB089_08290) - 1642250..1643440 (+) 1191 WP_374966000.1 phage major capsid protein -
  ACB089_RS08300 (ACB089_08295) - 1643479..1643634 (+) 156 WP_374966001.1 hypothetical protein -
  ACB089_RS08305 (ACB089_08300) - 1643624..1643914 (+) 291 WP_374966002.1 head-tail connector protein -
  ACB089_RS08310 (ACB089_08305) - 1643925..1644254 (+) 330 WP_374966003.1 phage head closure protein -
  ACB089_RS08315 (ACB089_08310) - 1644251..1644679 (+) 429 WP_374966004.1 HK97 gp10 family phage protein -
  ACB089_RS08320 (ACB089_08315) - 1644676..1645143 (+) 468 WP_374966005.1 DUF6838 family protein -
  ACB089_RS08325 (ACB089_08320) - 1645148..1646182 (+) 1035 WP_374966006.1 phage tail sheath C-terminal domain-containing protein -
  ACB089_RS08330 (ACB089_08325) - 1646197..1646628 (+) 432 WP_374966007.1 phage tail tube protein -
  ACB089_RS08335 (ACB089_08330) - 1646642..1647034 (+) 393 WP_374966008.1 hypothetical protein -
  ACB089_RS08340 (ACB089_08335) - 1647234..1649072 (+) 1839 WP_374966009.1 hypothetical protein -
  ACB089_RS08345 (ACB089_08340) - 1649086..1649505 (+) 420 WP_374966010.1 hypothetical protein -
  ACB089_RS08350 (ACB089_08345) - 1649508..1650485 (+) 978 WP_374966011.1 hypothetical protein -
  ACB089_RS08355 (ACB089_08350) - 1650487..1650846 (+) 360 WP_374966012.1 DUF2577 domain-containing protein -
  ACB089_RS08360 (ACB089_08355) - 1650846..1651292 (+) 447 WP_374966013.1 DUF2634 domain-containing protein -
  ACB089_RS08365 (ACB089_08360) - 1651293..1652336 (+) 1044 WP_374966014.1 baseplate J/gp47 family protein -
  ACB089_RS08370 (ACB089_08365) - 1652333..1652680 (+) 348 WP_374966015.1 hypothetical protein -
  ACB089_RS08375 (ACB089_08370) - 1652689..1653504 (+) 816 WP_374966016.1 putative phage tail protein -
  ACB089_RS08380 (ACB089_08375) - 1653504..1653818 (+) 315 WP_374966017.1 hypothetical protein -
  ACB089_RS08385 (ACB089_08380) - 1653815..1654639 (+) 825 WP_374966018.1 glycine-rich domain-containing protein -
  ACB089_RS08390 (ACB089_08385) - 1654651..1654932 (+) 282 WP_374966019.1 hypothetical protein -
  ACB089_RS08395 (ACB089_08390) - 1654934..1655101 (+) 168 WP_374966020.1 hypothetical protein -
  ACB089_RS08400 (ACB089_08395) - 1655180..1655407 (+) 228 WP_374966021.1 hypothetical protein -
  ACB089_RS08405 (ACB089_08400) - 1655463..1655708 (+) 246 WP_107893867.1 hemolysin XhlA family protein -
  ACB089_RS08410 (ACB089_08405) - 1655723..1655983 (+) 261 WP_374966022.1 phage holin -
  ACB089_RS08415 (ACB089_08410) - 1655980..1656726 (+) 747 WP_374966023.1 N-acetylmuramoyl-L-alanine amidase -
  ACB089_RS08420 (ACB089_08415) - 1656837..1656995 (-) 159 WP_374966024.1 hypothetical protein -
  ACB089_RS08425 (ACB089_08420) - 1657165..1657428 (-) 264 WP_374967525.1 Ger(x)C family spore germination C-terminal domain-containing protein -
  ACB089_RS08430 (ACB089_08425) - 1657415..1657684 (-) 270 WP_374966025.1 hypothetical protein -
  ACB089_RS08435 (ACB089_08430) - 1657875..1658102 (+) 228 WP_374966026.1 spore coat associated protein CotJA -
  ACB089_RS08440 (ACB089_08435) - 1658095..1658358 (+) 264 WP_374966027.1 spore coat protein CotJB -
  ACB089_RS08445 (ACB089_08440) - 1658384..1658953 (+) 570 WP_374966028.1 manganese catalase family protein -
  ACB089_RS08450 (ACB089_08445) - 1659000..1659248 (-) 249 WP_374966029.1 helix-turn-helix transcriptional regulator -
  ACB089_RS08455 (ACB089_08450) - 1659761..1660276 (-) 516 WP_374966030.1 SHOCT domain-containing protein -
  ACB089_RS08460 (ACB089_08455) - 1660376..1660585 (-) 210 WP_374966031.1 helix-turn-helix domain-containing protein -
  ACB089_RS08465 (ACB089_08460) - 1660762..1661655 (+) 894 WP_374966032.1 helix-turn-helix domain-containing protein -
  ACB089_RS08470 (ACB089_08465) - 1661798..1662007 (+) 210 WP_374966033.1 hypothetical protein -
  ACB089_RS08475 (ACB089_08470) - 1662061..1662669 (+) 609 WP_374966034.1 hypothetical protein -
  ACB089_RS08480 (ACB089_08475) ltrA 1663349..1664611 (+) 1263 WP_374963429.1 group II intron reverse transcriptase/maturase -

Sequence

Protein


Download         Length: 169 a.a.        Molecular weight: 18531.35 Da        Isoelectric Point: 5.3370

>NTDB_id=1038331 ACB089_RS08220 WP_374965986.1 1632379..1632888(+) (ssbA) [Lysinibacillus sp. RS10]
MINRVVLVGRLTKDPELRYTPNGVASCRFKVAVNRTFRGQDGEPEADFISCVAWRKQAENLANFQRKGNLIGVEGRIQTG
SYEGQDGKRVYTTDVVADSIQFLEPNKGSESAQNGSNVRSDASRGASPQNGSGGYKQPQNTQPNYTRVDEDPFANSKGPV
EVSEDDLPF

Nucleotide


Download         Length: 510 bp        

>NTDB_id=1038331 ACB089_RS08220 WP_374965986.1 1632379..1632888(+) (ssbA) [Lysinibacillus sp. RS10]
ATGATTAATCGCGTTGTATTAGTTGGCCGTTTAACAAAAGATCCTGAATTGCGCTATACACCAAATGGTGTTGCTTCATG
TCGCTTCAAAGTAGCCGTTAATCGAACATTCAGGGGGCAGGACGGAGAACCTGAAGCCGACTTTATTAGTTGCGTTGCTT
GGAGAAAGCAAGCTGAGAATCTAGCAAACTTTCAACGAAAAGGTAATTTAATAGGTGTTGAAGGACGAATTCAAACAGGT
AGTTATGAGGGGCAAGATGGCAAGCGCGTGTACACGACAGACGTTGTAGCCGATAGCATTCAATTCTTAGAGCCGAATAA
AGGCTCAGAAAGCGCTCAGAATGGTTCGAACGTGCGTTCTGATGCAAGTAGAGGGGCAAGTCCTCAAAACGGCTCAGGAG
GCTATAAACAGCCTCAAAACACACAGCCAAATTATACAAGGGTAGACGAAGATCCATTTGCAAATAGTAAAGGCCCTGTC
GAGGTGTCCGAAGATGATCTTCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.488

100

0.544
  ssb Latilactobacillus sakei subsp. sakei 23K

49.425

100

0.509

Multiple sequence alignment